Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
271 S_Total95_1336 IPI00017579.1 |SWISS-PROT:P00439 |TREMBL:Q8TEY0; Q66RJ9 |REFSEQ_NP:NP_000268 |ENSEMBL:ENSP00000303500 |H-INV:HIT000040161 Tax_Id=9606 Phenylalanine-4-hydroxylase 20 HDIGATVHELSR; DEYEFFTHLDK; RSLPALTNIIKILR; KDEYEFFTHLDK; IEVLDNTQQLK; TAIQNYTVTEFQPLYYVAESFNDAK; DFLGGLAFR; ILADSINSEIGILCSALQK; LFEENDVNLTHIESR; LRPVAGLLSSR; SFAQFSQEIGLASLGAPDEYIEK; THACYEYNHIFPLLEK; KQFADIAYNYR; NFAATIPRPFSVR; QFADIAYNYR; FANQILSYGAELDADHPGFK; AYGAGLLSSFGELQYCLSEKPK; IEVLDNTQQLKILADSINSEIGILCSALQKIK; YCGFHEDNIPQLEDVSQFLQTCTGFR; Comb; PMF 1 IPI00017579.1
272 S_Total95_1422 IPI00032875.1 |SWISS-PROT:Q16134-1 |TREMBL:Q547S8 |REFSEQ_NP:NP_004444 |ENSEMBL:ENSP00000303552 |H-INV:HIT000035519 Tax_Id=9606 Splice Isoform 1 of Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial precursor 20 GAPLNTPVTEDR; GIATNDVGIQK; ITTHYTIYPR; ELWVIDEK; ANCEPQTYGIGLK; SGILAAESIFNQLTSENLQSK; FCPAGVYEFVPVEQGDGFR; AAQIGAHTLSGACLDPGAFK; ALNEGGFQSIPK; FAEEADVVIVGAGPAGLSAAVR; LQINAQNCVHCK; NLSIYDGPEQR; TIGLHVTEYEDNLK; VDHTVGWPLDR; LTFPGGLLIGCSPGFMNVPK; HHPSIRPTLEGGK; VTIFAEGCHGHLAK; DPSQNINWVVPEGGGGPAYNGM; IPVPILPGLPMNNHGNYIVR; Comb; PMF 1 IPI00032875.1
273 S_Total95_1494 IPI00305152.5 |TREMBL:Q5XG74; O94979; Q86TJ0; Q9UM05; Q9UM06; Q5H9P6; Q7LCX9 |REFSEQ_NP:NP_055748 |ENSEMBL:ENSP00000347329; ENSP00000264405 |H-INV:HIT000003488; HIT000004635; HIT000000622 Tax_Id=9606 SEC31L1 protein 20 GDVSGVLIAGGENGNIILYDPSKIIAGDK; MADAIILAIAGGQELLARTQKK; NPAVLSAASFDGR; QVQHILASASPSGR; SDQLQQAVQSQGFINYCQK; TTFEDLIQR; AQDGSHPLSLQDLIEK; EQTLSPTITSGLHNIAR; IDASQTEFEK; TQPPEDISCIAWNR; LPVIQMWDLR; RPVGASFSFGGK; GRPGPVAGHHQMPR; KPIPDEHLILK; GDVSGVLIAGGENGNIILYDPSK; LENEGDSLLQTQACLCYICAGNVEK; LSSSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLK; PNIEGAPGAPIGNTFQHVQSLPTK; KIALALNKVDGANVALK; Comb 1 IPI00305152.5
274 S_Total95_1614 IPI00008524.1 |SWISS-PROT:P11940-1 |REFSEQ_NP:NP_002559 |ENSEMBL:ENSP00000313007; ENSP00000350613 |H-INV:HIT000037423; HIT000020049 Tax_Id=9606 Splice Isoform 1 of Polyadenylate-binding protein 1 20 GFGFVCFSSPEEATK; FSPAGPILSIR; PLYVALAQR; ALYDTFSAFGNILSCK; SLGYAYVNFQQPADAER; KAHLTNQYMQR; ITGMLLEIDNSELLHMLESPESLR; KEFSPFGTITSAK; LFPLIQAMHPTLAGK; VDEAVAVLQAHQAK; GFGFVSFER; NLDDGIDDERLR; IVATKPLYVALAQR; NLDDGIDDER; AVDEMNGKELNGK; EFSPFGTITSAK; NFGEDMDDER; SKVDEAVAVLQAHQAK; PAAAAAAATPAVR; Comb; PMF 1 IPI00008524.1
275 S_Total95_1648 IPI00001159.8 |SWISS-PROT:Q92616 |REFSEQ_NP:NP_006827 |ENSEMBL:ENSP00000300648 |H-INV:HIT000042355 Tax_Id=9606 GCN1-like protein 1 20 ENVNSLLPVFEEFLK; VLAFLSSVAGDALTR; VLPLEALVTDAGEVTEAGK; ALGTLVSHVTLR; GEPGAAPLSAPAFSLVFPFLK; SIIQSAQQDSIK; NPEILAIAPVLLDALTDPSR; ILPEIIPILEEGLR; MTTETASEDDNFGTAQSNK; QLDDEEVSEFALDGLK; AASQSTQVPTITEGVAAALLLLK; MIWWANKDPLPPLDPQAIKPILK; VGKGEPGAAPLSAPAFSLVFPFLK; LYRPPPVLDALGR; HHIETGGGQLPAK; ALQAAIQQLAEAQPEATAK; CVAGKDLPEGAVK; AGVPSKSSGSAALLALTWTCLLVRIVFPSR; NLLHSLQSSGIGSKAGVPSK; PMF 1 IPI00001159.8
276 S_Total95_2537 IPI00000690.1 |SWISS-PROT:O95831-1 |TREMBL:Q6I9X6 |REFSEQ_NP:NP_004199 |ENSEMBL:ENSP00000287295 |H-INV:HIT000003250 Tax_Id=9606 Splice Isoform 1 of Programmed cell death protein 8, mitochondrial precursor 20 AALSASEGEEVPQDK; DGEQHEDLNEVAK; ISGLGLTPEQK; ALGTEVIQLFPEK; TGGLEIDSDFGGFR; ELWFSDDPNVTK; KAALSASEGEEVPQDK; SNIWVAGDAACFYDIK; LNDGSQITYEK; CLIATGGTPR; VMPNAIVQSVGVSSGK; LLIKLKDGR; RVEHHDHAVVSGR; ILPEYLSNWTMEK; SITIIGGGFLGSELACALGR; SIYFQPPSFYVSAQDLPHIENGGVAVLTGK; VLIVSEDPELPYMRPPLSK; APSHVPFLLIGGGTAAFAAAR; KVETDHIVAAVGLEPNVELAK; QMASSGASGGK 1 IPI00000690.1
277 S_Total95_2738 IPI00010154.3 |SWISS-PROT:P31150 |TREMBL:Q6FG50; Q5HY38 |REFSEQ_NP:NP_001484 |H-INV:HIT000029512; HIT000035732; HIT000028541; HIT000015613 Tax_Id=9606 Rab GDP dissociation inhibitor alpha 20 FDLGQDVIDFTGHALALYR; NTNDANSCQIIIPQNQVNR; SPYLYPLYGLGELPQGFAR; KFDLGQDVIDFTGHALALYR; LYSESLAR; DWNVDLIPK; NPYYGGESSSITPLEELYK; DWNVDLIPKFLMANGQLVK; FLVFVANFDENDPK; MLLYTEVTR; TFEGVDPQTTSMR; VPSTETEALASNLMGMFEK; FQLLEGPPESMGR; GRDWNVDLIPK; EVEPALELLEPIDQK; QLICDPSYIPDR; TDDYLDQPCLETVNR; YIAIASTTVETTDPEK; KSDIYVCMISYAHNVAAQGK; YIAIASTTVETTDPEKEVEPALELLEPIDQK 1 IPI00010154.3
278 S_Total95_3393 IPI00298860.3 |SWISS-PROT:P02788 |TREMBL:Q8IX02; Q5EK51; Q5DSM0; Q8IWS6 |REFSEQ_NP:NP_002334 |ENSEMBL:ENSP00000231751 |H-INV:HIT000037350; HIT000037351; HIT000039489; HIT000018718 Tax_Id=9606 Lactotransferrin precursor 20 CSTSPLLEACEFLR; FDEYFSQSCAPGSDPR; GGSFQLNELQGLK; IDSGLYLGSGYFTAIQNLR; LADFALLCLDGK; LRPVAAEVYGTER; VVWCAVGEQELR; YLGPQYVAGITNLK; NLLFNDNTECLAR; SDTSLTWNSVK; KGGSFQLNELQGLK; FFSASCVPGADK; SNLCALCIGDEQGENK; CLAENAGDVAFVK; DVTVLQNTDGNNNEAWAK; EDAIWNLLR; RSVQWCAVSQPEATK; TAGWNVPIGTLR; SQQSSDPDPNCVDRPVEGYLAVAVVR; ESTVFEDLSDEAERDEYELLCPDNTR 1 IPI00298860.3
279 S_Total95_3613 IPI00009960.6 |SWISS-PROT:Q16891-1 |REFSEQ_NP:NP_006830 |ENSEMBL:ENSP00000254636 |H-INV:HIT000030873 Tax_Id=9606 Splice Isoform 1 of Mitochondrial inner membrane protein 20 VVSQYHELVVQAR; ANCSDNEFTQALTAAIPPESLTR; GIEQAVQSHAVAEEEAR; KAVDEAADALLK; TSSAETPTIPLGSAVEAIK; LSEQELQFR; AVDEAADALLK; ELDSITPEVLPGWK; SEFEQNLSEK; RKAVDEAADALLK; LSQEQVDNFTLDINTAYAR; IAGAGLLFVGGGIGGTILYAK; LFEMVLGPAAYNVPLPK; GVYSEETLR; YSTSGSSGLTTGK; LHNMIVDLDNVVK; ERPPEEVAARLAQQEK; TDHPEIGEGKPTPALSEEASSSSIR; QTASVTLQAIAAQNAAVQAVNAHSNILK; QKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLK 1 IPI00009960.6
280 S_Total95_3655 IPI00001890.5 |SWISS-PROT:Q9Y678 |TREMBL:Q8WUI6; Q54AC4 |REFSEQ_NP:NP_057212 |ENSEMBL:ENSP00000325002 |H-INV:HIT000004198; HIT000008421; HIT000007995; HIT000001859 Tax_Id=9606 Coatomer gamma subunit 20 AIVDCIISIIEENSESK; ALQQYTLEPSEKPFDLK; ATFYLNVLEQK; SIATLAITTLLK; TLEEAVGNIVK; ELAPAVSVLQLFCSSPK; SSPEPVALTESETEYVIR; SLPYNQPGTCYTLVALPK; VFNETPINPR; QEIFQEQLAAVPEFR; FGAQNEEMLPSILVLLK; LNFEAAWDEVGDEFEK; DSPLFDFIESCLR; ILHLLGQEGPK; EMSCIAEDVIIVTSLTK; HPSAVTACNLDLENLVTDSNR; KDEESGGGSNPFQHLEK; ETGLSHLCEFIEDCEFTVLATR; VPSVSSSALVSSLHLLK; LNFEAAWDEVGDEFEKEETFTLSTIK 1 IPI00001890.5
281 S_Total95_31 IPI00216057.4 |SWISS-PROT:Q00796 |REFSEQ_NP:NP_003095 |ENSEMBL:ENSP00000267814 |H-INV:HIT000039887; HIT000039074 Tax_Id=9606 Sorbitol dehydrogenase 19 ALEAFETFK; AMGAAQVVVTDLSATR; EIGADLVLQISK; KPMVLGHEASGTVEK; ALEAFETFKK; IGNFIVK; SGGTLVLVGLGSEMTTVPLLHAAIR; YCNTWPVAISMLASK; SVNVKPLVTHR; MHSVGICGSDVHYWEYGR; LENYPIPEPGPNEVLLR; LPDNVTFEEGALIEPLSVGIHACR; PNNLSLVVHGPGDLR; VAIEPGAPR; VLVCGAGPIGMVTLLVAK; YNLSPSIFFCATPPDDGNLCR; SVNVKPLVTHRFPLEK; HLKPGDRVAIEPGAPR; Comb; PMF 1 IPI00216057.4
282 S_Total95_51 IPI00336008.1 |TREMBL:Q8N3W6 |REFSEQ_NP:NP_733936 |ENSEMBL:ENSP00000314649 Tax_Id=9606 Aldehyde dehydrogenAse 5A1 precursor, isoform 1 19 YGIDEYLELK; EVGEAICTDPLVSK; AAYEAFCR; LAGLSAALLR; NTGQTCVCSNQFLVQR; VGNGFEEGTTQGPLINEK; VYGDIIHTPAK; RVYGDIIHTPAK; ISFTGSTTTGK; VEKQVNDAVSKGATVVTGGK; KVGAALAAGCTVVVK; GATVVTGGKRHQLGK; KWYNLMIQNK; ILLHHAANSVK; WLPAAATFPVQDPASGAALGMVADCGVR; NFFEPTLLCNVTQDMLCTHEETFGPLAPVIK; VAEQLEVGMVGVNEGLISSVECPFGGVK; GIHDAFVK; Comb; PMF 2 IPI00019888.1, IPI00336008.1
283 S_Total95_82 IPI00220301.4 |SWISS-PROT:P30041 |TREMBL:Q5TAH4 |REFSEQ_NP:NP_004896 |ENSEMBL:ENSP00000236251 |H-INV:HIT000020795; HIT000042159 Tax_Id=9606 Peroxiredoxin 6 19 VVFVFGPDK; DINAYNCEEPTEK; NFDEILR; VVFVFGPDKK; DFTPVCTTELGR; LSILYPATTGR; VVISLQLTAEK; ELAILLGMLDPAEK; ELAILLGMLDPAEKDEK; LPFPIIDDR; PGGLLLGDVAPNFEANTTVGR; LIALSIDSVEDHLAWSK; DGDSVMVLPTIPEEEAK; DGDSVMVLPTIPEEEAKK; FHDFLGDSWGILFSHPR; PGGLLLGDVAPNFEANTTVGRIR; DINAYNCEEPTEKLPFPIIDDR; NFDEILRVVISLQLTAEKR; Comb; PMF 1 IPI00220301.4
284 S_Total95_84 IPI00009268.1 |SWISS-PROT:Q03154 |REFSEQ_NP:NP_000657 |ENSEMBL:ENSP00000232907 |H-INV:HIT000029724; HIT000031367; HIT000036528 Tax_Id=9606 Aminoacylase-1 19 LLPALASVPALPSDS; EHWSHDPFEAFK; GPEEEHPSVTLFR; LHEAVFLR; VVNSILAFR; DSEGYIYAR; AGFALDEGIANPTDAFTVFYSER; AFEEQLQSWCQAAGEGVTLEFAQK; CVSIQYLEAVR; LEGGVAYNVIPATMSASFDFR; TVQPKPDYGAAVAFFEETAR; AVGVPALGFSPMNR; EGSVTSVNLTK; GVDIYTR; DMNLTLEPEIMPAATDNR; PDYGAAVAFFEETAR; TPVLLHDHDER; VEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK; PMF; Comb 1 IPI00009268.1
285 S_Total95_140 IPI00328156.8 |SWISS-PROT:P27338 |TREMBL:Q5HYN8; Q8TBI1 |REFSEQ_NP:NP_000889 |ENSEMBL:ENSP00000265833 |H-INV:HIT000039579 Tax_Id=9606 Amine oxidase [flavin-containing] B 19 ELGIETYK; FVGGSGQVSER; HLPSVPGLLR; IHFNPPLPMMR; LERPVIYIDQTR; LIGLTTIFSATALGFLAHK; VLGSLEALEPVHYEEK; YVDLGGSYVGPTQNR; ENVLVETLNHEMYEAK; LLHDSGLNVVVLEAR; PVIYIDQTR; APLAEEWDNMTMK; YVISAIPPTLGMK; GPFPPVWNPITYLDHNNFWR; IPEDEIWQSEPESVDVPAQPITTTFLER; IMDLLGDRVK; IYFAGTETATHWSGYMEGAVEAGER; NQMITRVPLGSVIK; Comb 1 IPI00328156.8
286 S_Total95_233 IPI00292657.3 |SWISS-PROT:Q14914 |TREMBL:Q9H1X5; Q5JVP3; Q5JVP4; Q8IYQ0 |REFSEQ_NP:NP_036344 |ENSEMBL:ENSP00000238248; ENSP00000311572 |H-INV:HIT000016815 Tax_Id=9606 NADP-dependent leukotriene B4 12-hydroxydehydrogenase 19 IAICGAISTYNR; LGFDVVFNYK; HFVGYPTNSDFELK; VVESKNVALPK; GGETVMVNAAAGAVGSVVGQIAK; TGPLPPGPPPEIVIYQELR; TVESLEETLKK; EYIIEGFENMPAAFMGMLK; GTIVLASPGWTTHSISDGK; GTIVLASPGWTTHSISDGKDLEK; NGEVLLEALFLTVDPYMR; TVESLEETLK; TAELPPLK; EGDTMMGQQVAK; MEAFVVYR; ASPDGYDCYFDNVGGEFSNTVIGQMK; KHFVGYPTNSDFELK; LKEGDTMMGQQVAK; PMF; Comb 1 IPI00292657.3
287 S_Total95_274 IPI00005668.3 |SWISS-PROT:P52895 |TREMBL:Q5SR16 |REFSEQ_NP:NP_001345; NP_995317 |ENSEMBL:ENSP00000307205 |H-INV:HIT000032994; HIT000016061 Tax_Id=9606 Similar to Aldo-keto reductase family 1 member C2 19 REDIFYTSK; TPALIALR; EDIFYTSK; EEPWVDPNSPVLLEDPVLCALAK; DIVLVAYSALGSHR; RTPALIALR; SKDIVLVAYSALGSHR; YKPVCNQVECHPYFNQR; NLQLDYVDLYLIHFPVSVK; LLEMILNKPGLK; LNDGHFMPVLGFGTYAPAEVPK; SIGVSNFNHR; ILFDTVDLCATWEAMEK; LWSNSHRPELVR; LWSNSHRPELVRPALER; LAIEAGFHHIDSAHVYNNEEQVGLAIR; YLTLDIFAGPPNYPFSDEY; QNVQVFEFQLTSEEMK; PMF; Comb 1 IPI00005668.3
288 S_Total95_383 IPI00024896.2 |SWISS-PROT:P30039 |REFSEQ_NP:NP_071412 |ENSEMBL:ENSP00000308466 |H-INV:HIT000010945; HIT000034540 Tax_Id=9606 MAWD binding protein 19 VNTENLLQVENTGK; GEPGGQTQAFDFYSR; TAIGNTLVQDICYSPDTQK; GGELGISLRPDGR; LHPTDNFAQSSCFGLR; NMNSTLTFVTLSGELR; IKNMNSTLTFVTLSGELR; EMNLSETAFIR; GGELGISLR; AEDGIVLDLPLYPAHPQDFHEVEDLIK; KLHPTDNFAQSSCFGLR; RAEDGIVLDLPLYPAHPQDFHEVEDLIK; WFTPASEVPLCGHATLASAAVLFHK; SFLENLKVNTENLLQVENTGK; YFAPWVGVAEDPVTGSAHAVLSSYWSQHLGK; GNPAAVCLLENELDEDMHQK; MKLPIFIADAFTAR; LPIFIADAFTAR; PMF; Comb 1 IPI00024896.2
289 S_Total95_417 IPI00556366.1 |TREMBL:Q6B0I1 |REFSEQ_NP:NP_000522 |ENSEMBL:ENSP00000039007 Tax_Id=9606 Ornithine carbamoyltransferase 19 GEYLPLLQGK; GYEPDASVTK; QSDLDTLAK; VLSSMADAVLAR; KPEEVDDEVFYSPR; LQAFQGYQVTMK; SLVFPEAENR; SLVFPEAENRK; VAASDWTFLHCLPR; WTIMAVMVSLLTDYSPQLQK; QKGEYLPLLQGK; FGMHLQAATPK; NFTGEEIKYMLWLSADLK; SLGMIFEK; EASIPIINGLSDLYHPIQILADYLTLQEHYSSLK; LSTETGFALLGGHPCFLTTQDIHLGVNESLTDTAR; WTIMAVMVSLLTDYSPQLQKPK; LLLTNDPLEAAHGGNVLITDTWISMGQEEEK; Comb; PMF 1 IPI00556366.1
290 S_Total95_557 IPI00290279.1 |SWISS-PROT:P55263-1 |TREMBL:Q5VXR4 |REFSEQ_NP:NP_006712 |ENSEMBL:ENSP00000286621 Tax_Id=9606 Splice Isoform Long of Adenosine kinase 19 AATFFGCIGIDK; SLIANLAAANCYK; ELFDELVK; IFTLNLSAPFISQFYK; AATFFGCIGIDKFGEILKR; YSLKPNDQILAEDK; VMPYVDILFGNETEAATFAR; TGCTFPEKPDFH; HLDLEKNWMLVEK; VAQWMIQQPHK; ENILFGMGNPLLDISAVVDK; VEYHAGGSTQNSIK; AGHYAASIIIR; EIIDTNGAGDAFVGGFLSQLVSDK; DDTIMATESEVTAFAVLDQDQK; EIIDTNGAGDAFVGGFLSQLVSDKPLTECIR; ENILFGMGNPLLDISAVVDKDFLDK; IVIFTQGR; PMF; Comb 1 IPI00290279.1
291 S_Total95_594 IPI00295386.6 |SWISS-PROT:P16152 |REFSEQ_NP:NP_001748 |ENSEMBL:ENSP00000290349 |H-INV:HIT000030953; HIT000037233 Tax_Id=9606 Carbonyl reductase [NADPH] 1 19 EGWPSSAYGVTK; FHQLDIDDLQSIR; LFSGDVVLTAR; DVCTELLPLIKPQGR; EYGGLDVLVNNAGIAFK; GQAAVQQLQAEGLSPR; GIGLAIVR; IGVTVLSR; ILLNACCPGWVR; KEYGGLDVLVNNAGIAFK; SETITEEELVGLMNK; VVNVSSIMSVR; DVCTELLPLIK; SPEEGAETPVYLALLPPDAEGPHGQFVSEK; ILLNACCPGWVRTDMAGPKATK; SETITEEELVGLMNKFVEDTKK; DVTRGQAAVQQLQAEGLSPR; LGVTVLSR; PMF; Comb 1 IPI00295386.6
292 S_Total95_707 IPI00291560.4 |SWISS-PROT:P05089-1 |REFSEQ_NP:NP_000036 |ENSEMBL:ENSP00000237310 |H-INV:HIT000038874 Tax_Id=9606 Splice Isoform 1 of Arginase 1 19 TGLLSGLDIMEVNPSLGK; DIVYIGLR; EGLYITEEIYK; TIGIIGAPFSK; VMEETLSYLLGR; YFSMTEVDR; DVDPGEHYILK; DYGDLPFADIPNDSPFQIVK; IPDVPGFSWVTPCISAK; GGVEEGPTVLR; ISLVLGGDHSLAIGSISGHAR; TVNTAVAITLACFGLAR; EGNHKPIDYLNPPK; KRPIHLSFDVDGLDPSFTPATGTPVVGGLTYR; RPIHLSFDVDGLDPSFTPATGTPVVGGLTYR; PIHLSFDVDGLDPSFTPATGTPVVGGLTYR; LKEQECDVKDYGDLPFADIPNDSPFQIVK; EQECDVKDYGDLPFADIPNDSPFQIVK; PMF; Comb 1 IPI00291560.4
293 S_Total95_814 IPI00014363.1 |TREMBL:Q9NXX7; Q9H2M3 |REFSEQ_NP:NP_060084 |ENSEMBL:ENSP00000255192 |H-INV:HIT000002483; HIT000038882 Tax_Id=9606 Betaine-homocysteine methyltransferase 2 19 AIAEELAPER; EGLEWAGLK; EAYNLGVR; EGFVDLPEYPFGLESR; GDALVAGGICQTSIYK; YIGGCCGFEPYHIR; AGLWTPEAVIEHPDAVR; WEDVNAAACDLAR; EYWENLLPASGR; PFCPSLSKPDF; HGSWGSGLDMHTK; AGASIVGVNCR; AGSNVMQTFTFSASEDNMESK; LESGEVVIGDGSFLITLEK; AHLMVQPLGFHAPDCGK; HGSWGSGLDMHTKPWIR; GFLPPASEK; FGPDTSLK; PMF; Comb 1 IPI00014363.1
294 S_Total95_824 IPI00289499.3 |SWISS-PROT:P31939 |TREMBL:Q53S28 |REFSEQ_NP:NP_004035 |ENSEMBL:ENSP00000236959 |H-INV:HIT000034046 Tax_Id=9606 Bifunctional purine biosynthesis protein PURH 19 EALGIPAAASFK; SGVAYIAAPSGSAADK; AEISNAIDQYVTGTIGEDEDLIK; LPITVLNGAPGFINLCDALNAWQLVK; TLFGLHLSQK; TLHPAVHAGILAR; VVACNLYPFVK; EVSDGIIAPGYEEEALTILSK; HVSPAGAAVGIPLSEDEAK; TGLVEFAR; YTQSNSVCYAK; NGQVIGIGAGQQSR; TLTPISAAYAR; ALFEEVPELLTEAEK; LTEVSISSDAFFPFR; DVSELTGFPEMLGGR; VTVVCEPEDYVVVSTEMQSSESK; AFTHTAQYDEAISDYFR; PMF; Comb 1 IPI00289499.3
295 S_Total95_873 IPI00296053.3 |SWISS-PROT:P07954 |TREMBL:Q5SY06 |REFSEQ_NP:NP_000134 |ENSEMBL:ENSP00000205832 |H-INV:HIT000031436; HIT000038011 Tax_Id=9606 Fumarate hydratase, mitochondrial precursor 19 AAAEVNQDYGLDPK; IEYDTFGELK; VAALTGLPFVTAPNK; EFAQIIK; SKEFAQIIK; YYGAQTVR; IYELAAGGTAVGTGLNTR; ETAIELGYLTAEQFDEWVKPK; THTQDAVPLTLGQEFSGYVQQVK; AIEMLGGELGSK; IEYDTFGELKVPNDK; LLGDASVSFTENCVVGIQANTER; SGLGELILPENEPGSSIMPGK; IPVHPNDHVNK; ETAIELGYLTAEQFDEWVK; LNDHFPLVVWQTGSGTQTNMNVNEVISNR; FEALAAHDALVELSGAMNTTACSLMK; LMNESLMLVTALNPHIGYDK; PMF; Comb 1 IPI00296053.3
296 S_Total95_1140 IPI00553185.2 |SWISS-PROT:P49368 |TREMBL:Q59H77 |REFSEQ_NP:NP_005989 |ENSEMBL:ENSP00000295688 |H-INV:HIT000033593; HIT000028109 Tax_Id=9606 T-complex protein 1, gamma subunit 19 ELGIWEPLAVK; IPGGIIEDSCVLR; TAVETAVLLLR; EILSEVER; IGDEYFTFITDCKDPK; IVLLDSSLEYK; TLIQNCGASTIR; WSSLACNIALDAVK; AVAQALEVIPR; KGESQTDIEITR; EDDVGTGAGLLEIK; IGDEYFTFITDCK; NLQDAMQVCR; AMTGVEQWPYR; ISIPVDISDSDMMLNIINSSITTK; MLLDPMGGIVMTNDGNAILR; ILQMEEEYIQQLCEDIIQLKPDVVITEK; NVLLDPQLVPGGGASEMAVAHALTEK; Comb; PMF 2 IPI00553185.2, IPI00290770.3
297 S_Total95_1194 IPI00455315.3 |SWISS-PROT:P07355 |TREMBL:Q567R4 |REFSEQ_NP:NP_001002857; NP_004030 |ENSEMBL:ENSP00000348640 |H-INV:HIT000039095; HIT000037682; HIT000037356; HIT000030371 Tax_Id=9606 Annexin A2 19 TPAQYDASELK; TNQELQEINR; DALNIETAIK; GVDEVTIVNILTNR; DIISDTSGDFR; SALSGHLETVILGLLK; TDLEKDIISDTSGDFR; DIISDTSGDFRK; GLGTDEDSLIEIICSR; KGTDVPKWISIMTER; SLYYYIQQDTK; QDIAFAYQR; GDLENAFLNLVQCIQNK; SYSPYDMLESIR; GDLENAFLNLVQCIQNKPLYFADR; LSLEGDHSTPPSAYGSVK; RAEDGSVIDYELIDQDAR; AEDGSVIDYELIDQDAR; Comb; PMF 1 IPI00455315.3
298 S_Total95_1239 IPI00292709.1 |SWISS-PROT:P35558 |REFSEQ_NP:NP_002582 |ENSEMBL:ENSP00000319814 |H-INV:HIT000039703 Tax_Id=9606 Phosphoenolpyruvate carboxykinase, cytosolic 19 EIISFGSGYGGNSLLGK; IFHVNWFR; EIISFGSGYGGNSLLGKK; FPGCMKGR; IIMHDPFAMR; VVQGSLDSLPQAVR; YLAAAFPSACGK; AINPENGFFGVAPGTSVK; YLEDQVNADLPCEIER; FLWPGFGENSR; YDNCWLALTDPR; VECVGDDIAWMK; TNLAMMNPSLPGWK; LLGQMEEEGILR; MGTPVLEALGDGEFVK; YLAHWLSMAQHPAAK; RPAGVPLVYEALSWQHGVFVGAAMR; FCTPASQCPIIDAAWESPEGVPIEGIIFGGR; Comb; PMF 1 IPI00292709.1
299 S_Total95_1254 IPI00030828.2 |SWISS-PROT:O95479 |TREMBL:Q68DT3; Q66I35 |REFSEQ_NP:NP_004276 |ENSEMBL:ENSP00000054661 Tax_Id=9606 Hypothetical protein DKFZp686A01246 19 TSFYEEYGVIR; LANDIEATAVR; ESPLVSAWSEELISK; LCAEEDQGAQIYAR; DIEAQLQHAGLR; DQFLQLSQYR; GHSFSFHGAALTAPK; GSAVVGQYQSYSEQVR; HWAAAQSQCLPR; LFGSPLSDYYAYSPVQER; LQVFQALR; QAVAQILPFR; IPYYNIHPMPVHLQQR; LLDFEFSSGR; MSLSLPLINR; TAEDYQALNK; ELQKPDSFHSLTPTFAAVLVHIDNLR; DAHSVLLSHIFHGR; Comb; PMF 1 IPI00030828.2
300 S_Total95_1295 IPI00002966.1 |SWISS-PROT:P34932 |TREMBL:O14992; Q59GF8; Q7KYN0 |REFSEQ_NP:NP_002145 |ENSEMBL:ENSP00000302961 Tax_Id=9606 Heat shock 70 kDa protein 4 19 GCALQCAILSPAFK; SNLAYDIVQLPTGLTGIK; TSTVDLPIENQLLWQIDR; EFSITDVVPYPISLR; LEDTENWLYEDGEDQPK; AGGIETIANEYSDR; ELSTTLNADEAVTR; LSQECEKLKK; VLATAFDTTLGGR; WNSPAEEGSSDCEVFSK; ELTSTCSPIISKPK; FLEMCNDLLAR; AESEEMETSQAGSK; MQVDQEEPHVEEQQQQTPAENK; SEENEEPMETDQNAK; AFSDPFVEAEK; NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK; NKEDQYDHLDAADMTK; Comb; PMF 1 IPI00002966.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home