Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
301 S_Total95_1316 IPI00000816.1 |SWISS-PROT:P62258 |TREMBL:Q53XZ5 |REFSEQ_NP:NP_006752 |ENSEMBL:ENSP00000264335 |H-INV:HIT000030416; HIT000029410 Tax_Id=9606 14-3-3 protein epsilon 19 DSTLIMQLLR; NLLSVAYK; EAAENSLVAYK; HLIPAANTGESK; KEAAENSLVAYK; LICCDILDVLDK; EALQDVEDENQ; YLAEFATGNDR; EENKGGEDKLK; AAFDDAIAELDTLSEESYK; AASDIAMTELPPTHPIR; LAEQAERYDEMVESMK; YLAEFATGNDRK; IISSIEQK; VAGMDVELTVEER; YDEMVESMK; DNLTLWTSDMQGDGEEQNK; AAFDDAIAELDTLSEESYKDSTLIMQLLR; Comb; PMF 1 IPI00000816.1
302 S_Total95_1366 IPI00217458.2 |SWISS-PROT:P24298 |REFSEQ_NP:NP_005300 |ENSEMBL:ENSP00000346821; ENSP00000301330 |H-INV:HIT000038314 Tax_Id=9606 Alanine aminotransferase 19 ALELEQELR; ECIEAVIR; DGGIPADPNNVFLSTGASDAIVTVLK; ALCVINPGNPTGQVQTR; AWALDVAELHR; ILQACGGHSLGAYSVSSGIQLIR; LLEETGICVVPGSGFGQR; QVLALCVNPDLLSSPNFPDDAK; AQELGLAPDMFFCLR; QAVLAELAAK; VLTLDGMNPR; ANIGDAQAMGQR; GGYVEVVNMDAAVQQQMLK; MTILPPLEK; LFLLADEVYQDNVYAAGSQFHSFK; LCPPVPGQALLDLVVSPPAPTDPSFAQFQAEK; TGVLIPIPQYPLYSATLAELGAVQVDYYLDEER; ANIGDAQAMGQRPITFLR; Comb; PMF 1 IPI00217458.2
303 S_Total95_1391 IPI00009771.4 |SWISS-PROT:Q03252 |REFSEQ_NP:NP_116126 |ENSEMBL:ENSP00000327054 |H-INV:HIT000032919 Tax_Id=9606 Lamin B2 19 LLEGEEER; EARMRLESLSYQLSGLQK; ISEKEEVTTR; SEVELAAALSDKR; ALYESELADAR; FVQLKNNSDKDQSLGNWR; LESLSYQLSGLQK; LSSDQNDKAASAAR; QVLEGEEIAYK; LELEQTYQAK; AGGPATPLSPTR; TVLVNADGEEVAMR; VTVSRATSSSSGSLSATGR; ATSSSSGSLSATGR; DVMQQQLAEYQELLDVK; GLESDVAELR; AGQMVTVWAAGAGVAHSPPSTLVWK; VKDLESLFHR; PMF 1 IPI00009771.4
304 S_Total95_1395 IPI00246058.3 |SWISS-PROT:Q8WUM4 |TREMBL:Q6NUS1 |REFSEQ_NP:NP_037506 |ENSEMBL:ENSP00000307387 |H-INV:HIT000001090; HIT000004596 Tax_Id=9606 PDCD6IP protein 19 STPVNVPISQK; DTIVLLCKPEPELNAAIPSANPAK; FIQQTYPSGGEEQAQYCR; FLTALAQDGVINEEALSVTELDR; FYNELTEILVR; LANQAADYFGDAFK; LLDEEEATDNDLR; NLATAYDNFVELVANLK; SVIEQGGIQTVDQLIK; SLLSNLDEVKK; TSEVDLAKPLVK; DAFDKGSLFGGSVK; CSDIVFAR; YYDQICSIEPK; MVPVSVQQSLAAYNQR; NIQVSHQEFSK; TMQGSEVVNVLK; HCIMQANAEYHQSILAK; Comb; PMF 1 IPI00246058.3
305 S_Total95_1822 IPI00376206.3 |TREMBL:Q86W23; Q7Z5P4 |REFSEQ_NP:NP_835236 |ENSEMBL:ENSP00000333300 Tax_Id=9606 Short-chain dehydrogenase/reductase 9 19 LWPVLETDEVVR; SLIDGILTNK; GLTSELQALGK; SLIDGILTNKK; SVAGEIVLITGAGHGIGR; EVGDVTIVVNNAGTVYPADLLSTK; FAAVGFHR; MIFVPSYINIFLR; TSCLCPVFVNTGFTK; TFEVNILGHFWITK; QSILVLWDINK; MQNIQFEAVVGHK; KSVAGEIVLITGAGHGIGR; EVGDVTIVVNNAGTVYPADLLSTKDEEITK; GVEETAAECR; QSILVLWDINKR; KLGVTAHAYVVDCSNR; RQSILVLWDINKR; PMF 1 IPI00376206.3
306 S_Total95_2246 IPI00297635.4 |TREMBL:O60363; Q53FZ2; Q13732 |REFSEQ_NP:NP_005613 |ENSEMBL:ENSP00000289416 Tax_Id=9606 SA hypertension-associated homolog isoform 1 variant 19 TGTVLIPGTTQLTQK; ANCIITNDVLAPAVDAVASK; VPEWWLANVACLR; FANILSEACSLQR; FEPTSILQTLSK; HCVSAGEPITPDVTEK; LGIPEYFNFAK; YPITVFCSAPTVYR; KPSNPAFWWINR; MLVQNDITSYK; WSFEELGSLSR; DGYFWFVAR; KVEFIQELPK; AFVVLNPDYK; GNFYITGDR; ADDVIISSGYR; VEFIQELPKTISGK; IGPFEVENALNEHPSVAESAVVSSPDPIR; PMF 1 IPI00297635.4
307 S_Total95_2403 IPI00292698.1 |SWISS-PROT:P28332 |REFSEQ_NP:NP_000663 |ENSEMBL:ENSP00000237653 Tax_Id=9606 Alcohol dehydrogenase 6 19 VTPGSTCAVFGLGGVGLSVVMGCK; ISGQLFFSGR; IDAVAPLEK; IIGVDVNK; AAILWKPGAPFSIEEVEVAPPK; AQELGATECLNPQDLK; INEAVELMKTGK; LNLDPLITHTLNLDK; PGAPFSIEEVEVAPPK; KAQELGATECLNPQDLK; SIYHFGNTSTFCEYTVIK; VCLISCGFSTGFGAAINTAK; VVATGLCGTEMK; INEAVELMK; LVADYMAEK; HLDLLYPTILGHEGAGIVESIGEGVSTVKPGDK; HLDLLYPTILGHEGAGIVESIGEGVSTVK; GSVFGGWK; IKVVATGLCGTEMK 2 IPI00478638.1, IPI00292698.1
308 S_Total95_2462 IPI00293125.2 |SWISS-PROT:Q99424 |REFSEQ_NP:NP_003491 |ENSEMBL:ENSP00000307697 Tax_Id=9606 Acyl-coenzyme A oxidase 2, peroxisomal 19 VELLSGEILPILQK; LENEPAIQQVLK; FAQVLPDGTYVK; LTNILDGGAQNTALR; VSLGDTWSR; SLQDHTPLPGIIIGDIGPK; ALSGDVALNIHR; GMHAFIVPIR; LSGLPSLVTK; TAYLDLLR; SATHALVQAQLICSGAR; SLSPSVAYLTAPDLAR; VLDYQTQQQK; SPTNTQENPAYEEYIR; LGTAQSNYLPMVVVR; SLGSEEQIAK; GFTEALEKLENEPAIQQVLK; SYLQTQMSPGSTPQR; DAILLTDAFDFTDQCLNSALGCYDGNVYER 1 IPI00293125.2
309 S_Total95_2502 IPI00549697.1 |TREMBL:Q6FIA4 |H-INV:HIT000025298 Tax_Id=9606 Isocitrate dehydrogenase [NADP] cytoplasmic 19 DIFQEIYDK; FKDIFQEIYDK; ATDFVVPGPGK; SDYLNTFEFMDK; TVEAEAAHGTVTR; VEITYTPSDGTQK; NILGGTVFR; DLAACIK; SEGGFIWACK; LIDDMVAQAMK; GQETSTNPIASIFAWTR; SIEDFAHSSFQMALSK; IIWELIK; LVSGWVEPIIIGR; ISGGSVVEMQGDEMTR; GWPLYLSTK; VTYLVHNFEEGGGVAMGMYNQDK; SIEDFAHSSFQMALSKGWPLYLSTKNTILK; KISGGSVVEMQGDEMTR 1 IPI00549697.1
310 S_Total95_2565 IPI00414384.1 |TREMBL:Q6YN16; Q658M8 |REFSEQ_NP:NP_115679 |ENSEMBL:ENSP00000262542 |H-INV:HIT000028647; HIT000015807 Tax_Id=9606 Hydroxysteroid dehydrogenase-like protein 19 DEQQISAAVEK; DGANIVIAAK; LAGCTVFITGASR; LLGTIYTAAEEIEAVGGK; ALPCIVDVRDEQQISAAVEK; KVESTGAVPEFKEEK; SFTGNFVIDENILK; VAHILNISPPLNLNPVWFK; VESTGAVPEFKEEK; RLDLMMNVNTR; DSLSDDVVK; ACIPYLK; KVESTGAVPEFK; FGGIDILVNNASAISLTNTLDTPTK; GGNVGYGEPSDQADVVMSMTTDDFVK; KVDIIADAAYSIFQKPK; TAIHTAAMDMLGGPGIESQCR; PGHPLQPDFFLDEYPEAVSK; ALPCIVDVR 1 IPI00414384.1
311 S_Total95_2595 IPI00180675.4 |SWISS-PROT:Q71U36 |TREMBL:Q9UQM3 |REFSEQ_NP:NP_006000 |ENSEMBL:ENSP00000301071 Tax_Id=9606 Tubulin alpha-3 chain 19 IHFPLATYAPVISAEK; VGINYQPPTVVPGGDLAK; FDGALNVDLTEFQTNLVPYPR; NLDIERPTYTNLNR; QIFHPEQLITGK; AVCMLSNTTAIAEAWAR; RNLDIERPTYTNLNR; YMACCLLYR; AYHEQLSVAEITNACFEPANQMVK; AFVHWYVGEGMEEGEFSEAR; QLFHPEQLITGK; QLFHPEQLITGKEDAANNYAR; DVNAAIATIK; EIIDLVLDR; TIGGGDDSFNTFFSETGAGK; AVFVDLEPTVIDEVR; TIQFVDWCPTGFK; LIGQIVSSITASLR; DYEEVGVDSVEGEGEEEGEEY 1 IPI00180675.4
312 S_Total95_2623 IPI00027497.4 |SWISS-PROT:P06744 |TREMBL:Q9BRD3 |REFSEQ_NP:NP_000166 |ENSEMBL:ENSP00000327074; ENSP00000348877 |H-INV:HIT000032131 Tax_Id=9606 Glucose-6-phosphate isomerase 19 EWFLQAAK; ILLANFLAQTEALMR; TFTTQETITNAETAK; TLAQLNPESSLFIIASK; VFEGNRPTNSIVFTK; VWYVSNIDGTHIAK; MIPCDFLIPVQTQHPIRK; NLVTEDVMRMLVDLAK; FAAYFQQGDMESNGK; SNTPILVDGK; EFGIDPQNMFEFWDWVGGR; HFVALSTNTTK; MIPCDFLIPVQTQHPIR; NLVTEDVMR; IEPELDGSAQVTSHDASTNGLINFIK; KIEPELDGSAQVTSHDASTNGLINFIK; TITDVINIGIGGSDLGPLMVTEALKPYSSGGPR; VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK; AVLHVALR 1 IPI00027497.4
313 S_Total95_2858 IPI00237806.2 |SWISS-PROT:P11277-3 |TREMBL:O14724; Q71VG1; Q71VG0; O14726; O14725; Q71VG2 |ENSEMBL:ENSP00000345913 Tax_Id=9606 Splice Isoform 3 of Spectrin beta chain, erythrocyte 19 HRPDLIDFDKLK; ETWLSENQR; HRPDLIDFDK; FANSLTGVQQQLQAFSTYR; LWSYLQELLQSR; NLQDAENFFQFQGDADDLK; EQEVSAAWQALLDACAGR; LLTSQDVSYDEAR; VDNVNAFIER; ANNQKVYTPHDGK; YHQGINAEIETRSK; LLEVLSGEMLPK; LVAEGNLYSDK; PQFTALVSQKLEALHR; QLESSRAKLQISR; RFLDLLEPLGR; FLDLLEPLGR; LEGLDTGWNALGR; VGKVIDHAIETEKMIEK 1 IPI00237806.2
314 S_Total95_2881 IPI00549544.1 |SWISS-PROT:O60763 |TREMBL:Q6PK63; Q8N592 |REFSEQ_NP:NP_003706 |ENSEMBL:ENSP00000264904 |H-INV:HIT000041654; HIT000004567 Tax_Id=9606 General vesicular transport factor p115 19 NQELLQSQLTEK; EQDLQLEELR; NDGVLLLQALTR; SQLNSQSVEITK; SSQTSGTNEQSSAIVSAR; TLEQHDNIVTHYK; VLVSPTNPPGATSSCQK; DSEQVAELKQELATLK; IVAFENAFER; LSALLQETK; QSEDLGSQFTEIFIK; VTNLHLMLQLVR; DSEQVAELK; SVEVQGETETIIATK; EQLDSSNSTIAILQTEK; QLGPQVQQIILVSPMGVSR; VASSTLLDDR; EQDDLLVLLADQDQK; CQNEQLQTAVTQQVSQIQQHK 1 IPI00549544.1
315 S_Total95_3168 IPI00218852.2 |SWISS-PROT:P09327 |TREMBL:Q53F91; Q53S11; Q96AC8 |REFSEQ_NP:NP_009058 |ENSEMBL:ENSP00000248444 |H-INV:HIT000037931 Tax_Id=9606 Villin 1 19 AAVPDTVVEPALK; DPETPIIVVK; LYHVSDSEGNLVVR; GAMSHALNFIK; LQEENLVITPR; AAATTAQEYLK; ANFLNSNDVFVLK; DWSQITAEVTSPK; IENLELVPVDSK; LFQVQGTGANNTK; TYVGVVDGENELASPK; TQSCCYLWCGK; GSLNITTPGLQIWR; EVQGNESEAFR; LIIQWNGPESTR; MVDDGSGEVQVWR; PLTQDLLSHEDCYILDQGGLK; VDVFNANSNLSSGPLPIFPLEQLVNKPVEELPEGVDPSR; GDVFLLDLGKLIIQWNGPESTRMER 1 IPI00218852.2
316 S_Total95_3510 IPI00216219.2 |SWISS-PROT:Q07157-1 |TREMBL:Q9H317; Q4ZGJ6 |REFSEQ_NP:NP_003248 |ENSEMBL:ENSP00000348416 Tax_Id=9606 Splice Isoform Long of Tight junction protein ZO-1 19 SNHYDPEEDEEYYR; IVESDVGDSFYIR; DGNIQEGDVVLK; EAGFLRPVTIFGPIADVAR; GGPAEGQLQENDR; EDLSAQPVQTK; AEQLASVQYTLPK; FPAYERVVLR; LRPEAQPHPSAGPK; EPNLTYEPQLPYVEK; FNHNLLPSETAHK; LAGGNDVGIFVAGVLEDSPAAK; PVTIFGPIADVAR; VPMYEEQWSYYDDK; LRPEAQPHPSAGPKPAESK; FNHNLLPSETAHKPDLSSK; SFENKPPAHIAASHLSEPAK; DQEPSLSSHVDPTK; LEEPTPAPSTSYSPQADSLR 1 IPI00216219.2
317 S_Total95_3669 IPI00220834.7 |SWISS-PROT:P13010 |TREMBL:Q53HH7; Q9UCQ1; Q53T09; Q53TC2 |REFSEQ_NP:NP_066964 |ENSEMBL:ENSP00000329528 |H-INV:HIT000009440; HIT000038511; HIT000021263 Tax_Id=9606 ATP-dependent DNA helicase II, 80 kDa subunit 19 ANPQVGVAFPHIK; DKPSGDTAAVFEEGGDVDDLLDMI; FNNFLKALQEKVEIK; LGGHGPSFPLK; SQLDIIIHSLK; SQLDIIIHSLKK; TDTLEDLFPTTK; EEASGSSVTAEEAK; ETVYCLNDDDETEVLK; YGSDIVPFSK; YAPTEAQLNAVDALIDSMSLAK; HLMLPDFDLLEDIESK; LTIGSNLSIR; HIEIFTDLSSR; ETVYCLNDDDETEVLKEDIIQGFR; DQVTAQEIFQDNHEDGPTAK; DDEAAAVALSSLIHALDDLDMVAIVR; ASFEEASNQLINHIEQFLDTNETPYFMK; EGLEIVKMVMISLEGEDGLDEIYSFSESLR 1 IPI00220834.7
318 S_Total95_3724 IPI00556322.1 |TREMBL:Q6GTT7 |REFSEQ_NP:NP_057535 |ENSEMBL:ENSP00000249923 |H-INV:HIT000025189; HIT000003677 Tax_Id=9606 Coatomer protein complex, subunit beta 19 DLQHPNEFIR; EAGELKPEEEITVGPVQK; LVEKPSPLTLAPHDFANIK; NAVLAIYTIYR; TLQLALDLVSSR; VASTENGIIFGNIVYDVSGAASDR; YEAAGTLVTLSSAPTAIK; SLGEIPIVESEIKK; CIYNLLQSSSPAVK; NVTVQPDDPISFMQLTAK; VLSECSPLMNDIFNK; VLQDLVMDILR; EAELLEPLMPAIR; EDIQSVMTEIR; NDLEKGDVKSK; NFEHLIPDAPELIHDFLVNEK; SIFGEDALANVSIEKPIHQGPDAAVTGHIR; ARFIRCIYNLLQSSSPAVK; KVIIMILNGEKLPGLLMTIIR 1 IPI00556322.1
319 S_Total95_4026 IPI00298281.3 |SWISS-PROT:P11047 |TREMBL:Q5VYE7; Q6NVY8 |REFSEQ_NP:NP_002284 |ENSEMBL:ENSP00000258341 |H-INV:HIT000037203 Tax_Id=9606 Laminin gamma-1 chain precursor 19 NTIEETGNLAEQAR; CIYNTAGFYCDR; EAQQALGSAAADATEAK; LSAEDLVLEGAGLR; SYYYAISDFAVGGR; DTLQEANDILNNLK; LCQCSDNIDPNAVGNCNR; SQECYFDPELYR; TLPSGCFNTPSIEKP; SAGYLDDVTLASAR; YEQAKNISQDLEK; EVVCTNCPTGTTGK; ATAESASECLPCDCNGR; DGSEASLEWSSER; PSAYNFDNSPVLQEWVTATDIR; QDIAVISDSYFPR; TFAEVTDLDNEVNNMLK; AVEIYASVAQLSPLDSETLENEANNIK; LQELESLIANLGTGDEMVTDQAFEDR 1 IPI00298281.3
320 S_Total95_4114 IPI00237884.1 |SWISS-PROT:Q02952-1 |TREMBL:Q5SZ80; Q86TJ9 |REFSEQ_NP:NP_005091 |ENSEMBL:ENSP00000253332 Tax_Id=9606 OTTHUMP00000017426 19 TEGTQEADQYADEK; EESESTAVGQAHSDISK; LVQNIIQTAVDQFVR; SDEVDEQVACQEVK; SAESPTSPVTSETGSTFK; ETCVSGEDPTQGADLSPDEK; EGEEPQASAQDETPITSAK; VDAQEAKTEPFTQGK; GESSASSPEEPEEITCLEK; GLAEVQQDGEAEEGATSDGEK; SATLSSTESTASEMQEEMK; SEDSIAGSGVEHSTPDTEPGK; GGGDEESGEHTQVPADSPDSQEEQK; AEAERPEEQAEASGLKK; TEVEETAGSVPAEELVEMDAEPQEAEPAK; EQEPEKVDTEEDGKAEVASEK; EDEKGDDVDDPENQNSALADTDASGGLTK; LTASEQAHPQEPAESAHEPR; EVIAEEEPPTVTEPLPENR 2 IPI00237884.1, IPI00217683.2
321 S_Total95_4115 IPI00479064.3 |TREMBL:Q5CZB5; Q68D82 |ENSEMBL:ENSP00000346702 Tax_Id=9606 Hypothetical protein DKFZp686O0331 19 TEGTQEADQYADEK; EESESTAVGQAHSDISK; LVQNIIQTAVDQFVR; SDEVDEQVACQEVK; SAESPTSPVTSETGSTFK; ETCVSGEDPTQGADLSPDEK; EGEEPQASAQDETPITSAK; VDAQEAKTEPFTQGK; GESSASSPEEPEEITCLEK; GLAEVQQDGEAEEGATSDGEK; SATLSSTESTASEMQEEMK; SEDSIAGSGVEHSTPDTEPGK; GGGDEESGEHTQVPADSPDSQEEQK; AEAERPEEQAEASGLKK; TEVEETAGSVPAEELVEMDAEPQEAEPAK; EQEPEKVDTEEDGKAEVASEK; EDEKGDDVDDPENQNSALADTDASGGLTK; LTASEQAHPQEPAESAHEPR; KDEGEGAAGAGDHQDPSLGAGEAASK 1 IPI00479064.3
322 S_Total95_4693 IPI00013452.7 |SWISS-PROT:P07814 |TREMBL:Q5H9S5; Q6PD57; Q86X73; Q5DSM1 |REFSEQ_NP:NP_004437 |ENSEMBL:ENSP00000259146 Tax_Id=9606 Hypothetical protein DKFZp313B047 19 FAGGDYTTTIEAFISASGR; LNQWCNVVR; INEAVECLLSLK; SLYDEVAAQGEVVR; NSEPAGLETPEAK; RLLSVNIR; LTVAENEAETK; NQGGGLSSSGAGEGQGPK; GSQFGQSCCLR; AIQGGTSHHLGQNFSK; DQDLEPGAPSMGAK; DQVDIAVQELLQLK; EYIPGQPPLSQSSDSSPTR; NLQMWEEMK; FNHWELKGVPIR; TGQEYKPGNPPAEIGQNISSNSSASILESK; TGKEYIPGQPPLSQSSDSSPTRNSEPAGLETPEAK; VTWLAETTHALPIPVICVTYEHLITK; YNVYPTYDFACPIVDSIEGVTHALR 1 IPI00013452.7
323 S_Total95_5419 IPI00291802.3 |SWISS-PROT:Q8WWI1-3 |TREMBL:Q5TBK6; Q5TBK5 |REFSEQ_NP:NP_005349 |ENSEMBL:ENSP00000317867 |H-INV:HIT000016919; HIT000015045 Tax_Id=9606 Splice Isoform 3 of LIM domain only protein 7 19 NHQLYCNDCYLR; TSTTGVATTQSPTPR; CVACECDLGGSSSGAEVR; QLRYEEMQKIK; LPSPTSPFSSLSQDQAATSK; NPSSSVPPPSAGSVK; EEREEIEK; EVAATEEDVTR; RPPTMTVSEASYQSER; SMSDVSAEDVQNLR; TEEASSGFLPGDR; GEFLAPPRHHK; GGREGFESDTDSEFTFK; SQFFEQGSSDSVVPDLPVPTISAPSR; STTELDDYSTNK; VTTEIQLPSQSPVEEQSPASLSSLR; TPNNVVSTPAPSPDASQLASSLSSQK; RQPQEEVVHEDQGK; SWASPVYTEADGTFSR 1 IPI00291802.3
324 S_Total95_6-1 IPI00419920.2 |SWISS-PROT:O00748-2 |TREMBL:Q6IPK9 |REFSEQ_NP:NP_932327 |H-INV:HIT000026684 Tax_Id=9606 Carboxylesterase 2 isoform 2 18 FTEEEEQLSR; IQELEEPEER; LGVLGFFSTGDK; SKEEILAINKPFK; TTHTGQVLGSLVHVK; WVQQNIAHFGGNPDR; ARLSAVACGLLLLLVR; MIPGVVDGVFLPR; YWANFAR; NIRPPHMKADHVK; HATGNWGYLDQVAALR; MLTLLMLPPTFGDLLR; APVYFYEFQHQPSWLK; HPQELLASADFQPVPSIVGVNNNEFGWLIPK; LGVLGFFSTGDKHATGNWGYLDQVAALR; NGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGR; FAPPEPPESWSGVR; EEILAINKPFK 1 IPI00419920.2
325 S_Total95_6-2 IPI00332828.1 |SWISS-PROT:O00748-1 |TREMBL:Q53H57 |REFSEQ_NP:NP_003860 |ENSEMBL:ENSP00000317842 |H-INV:HIT000020377 Tax_Id=9606 Carboxylesterase 2 isoform 1 18 FTEEEEQLSR; IQELEEPEER; LGVLGFFSTGDK; SKEEILAINKPFK; TTHTGQVLGSLVHVK; WVQQNIAHFGGNPDR; ARLSAVACGLLLLLVR; MIPGVVDGVFLPR; YWANFAR; HATGNWGYLDQVAALR; MLTLLMLPPTFGDLLR; APVYFYEFQHQPSWLK; HPQELLASADFQPVPSIVGVNNNEFGWLIPK; LGVLGFFSTGDKHATGNWGYLDQVAALR; NGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGR; FAPPEPPESWSGVR; EEILAINKPFK; ADHGDELPFVFR 1 IPI00332828.1
326 S_Total95_86 IPI00218474.4 |SWISS-PROT:P13929 |TREMBL:Q9NPL4; Q9UCG5 |REFSEQ_NP:NP_443739; NP_001967 |ENSEMBL:ENSP00000324105 |H-INV:HIT000037904 Tax_Id=9606 Beta enolase 18 AAVPSGASTGIYEALELR; SGETEDTFIADLVVGLCTGQIK; VNQIGSVTESIQACK; FGANAILGVSLAVCK; GNPTVEVDLHTAK; TAIQAAGYPDK; FMIELDGTENK; AVENINNTLGPALLQK; DATNVGDEGGFAPNILENNEALELLK; HIADLAGNPDLILPVPAFNVINGGSHAGNK; IGAEVYHHLK; ACNCLLLK; VVIGMDVAASEFYR; LAMQEFMILPVGASSFK; FGANAILGVSLAVCKAGAAEK; LAQSNGWGVMVSHR; IEEALGDKAIFAGR; PMF; Comb 1 IPI00218474.4
327 S_Total95_91 IPI00218816.6 |SWISS-PROT:P68871 |TREMBL:Q14484; Q6R7N2; Q9HAR8; Q14477; Q9UBV6; Q6VFQ6; Q8IZI0; Q7Z7B3; Q9H1I6; Q9UM85; Q6V0K9; Q8IZI1; Q9UK54; Q7Z2K5; Q670S4; Q6J1Z7; Q549N7; Q6VFQ5; Q9BXA2; Q86VF0; Q52MT0; O95408; Q8IUL9; Q9UP81; Q6FI08; O95412; Q9GZL9; Q9BWU5; Q9BWV6 |REFSEQ_NP:NP_000509 |ENSEMBL:ENSP00000333994 |H-INV:HIT000033032 Tax_Id=9606 Hemoglobin beta chain 18 EFTPPVQAAYQK; VLGAFSDGLAHLDNLK; VNVDEVGGEALGR; GTFATLSELHCDK; SAVTALWGK; VVAGVANALAHK; VVAGVANALAHKYH; FFESFGDLSTPDAVMGNPK; KVLGAFSDGLAHLDNLK; LLGNVLVCVLAHHFGK; LLVVYPWTQR; LHVDPENFR; LLGNVLVCVLAHHFGKEFTPPVQAAYQK; SAVTALWGKVNVDEVGGEALGR; VLGAFSDGLAHLDNLKGTFATLSELHCDK; GTFATLSELHCDKLHVDPENFR; VHLTPEEK; Comb; PMF 1 IPI00218816.6
328 S_Total95_92 IPI00473011.2 |SWISS-PROT:P02042 |REFSEQ_NP:NP_000510 Tax_Id=9606 Hemoglobin delta chain 18 VLGAFSDGLAHLDNLK; VVAGVANALAHK; VVAGVANALAHKYH; KVLGAFSDGLAHLDNLK; LLVVYPWTQR; LHVDPENFR; VNVDAVGGEALGR; FFESFGDLSSPDAVMGNPK; TAVNALWGK; EFTPQMQAAYQK; GTFSQLSELHCDK; LLGNVLVCVLAR; VHLTPEEK; LLGNVLVCVLARNFGK; VLGAFSDGLAHLDNLKGTFSQLSELHCDK; GTFSQLSELHCDKLHVDPENFR; Comb; PMF; NFGKEFTPQMQAAYQK 1 IPI00473011.2
329 S_Total95_114 IPI00219018.5 |SWISS-PROT:P04406 |TREMBL:Q5ZEY3; Q5D0F4; Q16768 |REFSEQ_NP:NP_002037 |ENSEMBL:ENSP00000229239 |H-INV:HIT000034167; HIT000040230; HIT000036204; HIT000009799; HIT000030508; HIT000031710; HIT000040030; HIT000040848 Tax_Id=9606 Hypothetical protein 18 GALQNIIPASTGAAK; VPTANVSVVDLTCR; LVINGNPITIFQER; LISWYDNEFGYSNR; IISNASCTTNCLAPLAK; VIHDNFGIVEGLMTTVHAITATQK; WGDAGAEYVVESTGVFTTMEK; LVINGNPITIFQERDPSK; RVIISAPSADAPMFVMGVNHEK; VGVNGFGR; VIISAPSADAPMFVMGVNHEK; VVDLMAHMASK; AGAHLKGGAK; GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVK; VVDLMAHMASKE; AGAHLQGGAK; AGAHLQGGAKR; PMF; Comb 1 IPI00219018.5
330 S_Total95_124 IPI00465028.5 |SWISS-PROT:P60174-1 |TREMBL:Q6FHP9; Q53HE2 |REFSEQ_NP:NP_000356 |ENSEMBL:ENSP00000229270 |H-INV:HIT000037004; HIT000034284; HIT000038196; HIT000033038; HIT000033462; HIT000035328 Tax_Id=9606 Triosephosphate isomerase 1 variant 18 FFVGGNWK; HVFGESDELIGQK; IIYGGSVTGATCK; KQSLGELIGTLNAAK; SNVSDAVAQSTR; QSLGELIGTLNAAK; KFFVGGNWK; ELASQPDVDGFLVGGASLKPEFVDIINAK; VAHALAEGLGVIACIGEK; VPADTEVVCAPPTAYIDFAR; VTNGAFTGEISPGMIK; VVLAYEPVWAIGTGK; RHVFGESDELIGQK; IAVAAQNCYK; MNGRKQSLGELIGTLNAAK; TATPQQAQEVHEK; TATPQQAQEVHEKLR; PMF; Comb 1 IPI00465028.5
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home