Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
331 S_Total95_126 IPI00550069.2 |SWISS-PROT:P13489 |TREMBL:Q59GB3; Q96FD7 |REFSEQ_NP:NP_976321; NP_976318; NP_976322; NP_976320; NP_002930; NP_976323; NP_976317; NP_976319 |ENSEMBL:ENSP00000346402; ENSP00000348515; ENSP00000072713 |H-INV:HIT000026159; HIT000036821 Tax_Id=9606 Placental ribonuclease inhibitor 18 ELDLSNNCLGDAGILQLVESVR; ELSLAGNELGDEGAR; LLCETLLEPGCQLESLWVK; LQLEYCSLSAASCEPLASVLR; SNELGDVGVHCVLQGLQTPSCK; VNPALAELNLR; WAELLPLLQQCQVVR; ELCQGLGQPGSVLR; LSLQNCCLTGAGCGVLSSTLR; CKDISSALR; LESCGVTSDNCR; DSPCQLEALK; LDDCGLTEAR; TLWIWECGITAK; TLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCR; ELTVSNNDINEAGVR; FLLELQISNNR; Comb 1 IPI00550069.2
332 S_Total95_151 IPI00020599.1 |SWISS-PROT:P27797 |TREMBL:Q53G71; Q6IAT4 |REFSEQ_NP:NP_004334 |ENSEMBL:ENSP00000320866 |H-INV:HIT000033527; HIT000030944; HIT000038786 Tax_Id=9606 Calreticulin precursor 18 VHVIFNYK; KVHVIFNYK; EQFLDGDGWTSR; IDNSQVESGSLEDDWDFLPPKK; SGTIFDNFLITNDEAYAEEFGNETWGVTK; FYALSASFEPFSNK; IDNSQVESGSLEDDWDFLPPK; IKDPDASKPEDWDER; DPDASKPEDWDER; FYGDEEKDKGLQTSQDAR; IDDPTDSKPEDWDKPEHIPDPDAK; HEQNIDCGGGYVK; KPEDWDEEMDGEWEPPVIQNPEYK; DDEFTHLYTLIVRPDNTYEVK; GTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVK; EDDEDKDEDEEDEEDKEEDEEEDVPGQAK; PEDWDEEMDGEWEPPVIQNPEYK; PMF; Comb 1 IPI00020599.1
333 S_Total95_157 IPI00007750.1 |SWISS-PROT:P68366 |REFSEQ_NP:NP_005991 |ENSEMBL:ENSP00000248437 |H-INV:HIT000011345; HIT000034219 Tax_Id=9606 Tubulin alpha-1 chain 18 DVNAAIAAIK; LISQIVSSITASLR; SIQFVDWCPTGFK; IHFPLATYAPVISAEK; VGINYQPPTVVPGGDLAK; AVFVDLEPTVIDEIR; FDGALNVDLTEFQTNLVPYPR; NLDIERPTYTNLNR; QIFHPEQLITGK; TIGGGDDSFTTFFCETGAGK; AVCMLSNTTAIAEAWAR; RNLDIERPTYTNLNR; YMACCLLYR; AYHEQLSVAEITNACFEPANQMVK; AFVHWYVGEGMEEGEFSEAR; QLFHPEQLITGK; QLFHPEQLITGKEDAANNYAR; PMF; Comb 1 IPI00007750.1
334 S_Total95_158 IPI00218343.4 |SWISS-PROT:Q9BQE3 |REFSEQ_NP:NP_116093 |ENSEMBL:ENSP00000301072 |H-INV:HIT000032545; HIT000035455; HIT000039076; HIT000032104; HIT000038618 Tax_Id=9606 Tubulin alpha-6 chain 18 LISQIVSSITASLR; IHFPLATYAPVISAEK; VGINYQPPTVVPGGDLAK; FDGALNVDLTEFQTNLVPYPR; NLDIERPTYTNLNR; QIFHPEQLITGK; RNLDIERPTYTNLNR; YMACCLLYR; AFVHWYVGEGMEEGEFSEAR; QLFHPEQLITGK; QLFHPEQLITGKEDAANNYAR; DVNAAIATIK; EIIDLVLDR; TIGGGDDSFNTFFSETGAGK; AVFVDLEPTVIDEVR; TIQFVDWCPTGFK; DYEEVGADSADGEDEGEEY; PMF; Comb 1 IPI00218343.4
335 S_Total95_181 IPI00008603.1 |SWISS-PROT:P62736 |TREMBL:Q5T9N7; Q6FI19 |REFSEQ_NP:NP_001604 |ENSEMBL:ENSP00000224784 |H-INV:HIT000038044 Tax_Id=9606 Actin, aortic smooth muscle 18 DLTDYLMK; EITALAPSTMK; SYELPDGQVITIGNER; AVFPSIVGRPR; AGFAGDDAPR; LDLAGRDLTDYLMK; AVFPSIVGR; QEYDEAGPSIVHR; DSYVGDEAQSK; VAPEEHPTLLTEAPLNPK; YPIEHGIITNWDDMEK; HQGVMVGMGQK; LCYVALDFENEMATAASSSSLEK; CPETLFQPSFIGMESAGIHETTYNSIMK; DLYANNVLSGGTTMYPGIADR; GYSFVTTAER; IWHHSFYNELR; Comb; PMF 1 IPI00008603.1
336 S_Total95_190 IPI00000792.1 |SWISS-PROT:Q08257 |TREMBL:Q5HYE7; Q6NSK9; Q59EU7; Q53FT0 |REFSEQ_NP:NP_001880 |ENSEMBL:ENSP00000263416; ENSP00000339399 Tax_Id=9606 Quinone oxidoreductase 18 VFEFGGPEVLK; SDIAVPIPK; ESSIIGVTLFSSTK; KPLLPYTPGSDVAGVIEAVGDNASAFK; VHACGVNPVETYIR; QGAAIGIPYFTAYR; VFTSSTISGGYAEYALAADHTVYK; AGESVLVHGASGGVGLAACQIAR; GTIEINPRDTMAKESSIIGVTLFSSTK; LRSDIAVPIPK; VAEAHENIIHGSGATGK; DLSLLSHGGR; PVIGSQYPLEK; KPLLPYTPGSDVAGVIEAVGDNASAFKK; EEFQQYAAALQAGMEIGWLKPVIGSQYPLEK; PLLPYTPGSDVAGVIEAVGDNASAFK; IVLQNGAHEVFNHR; PMF; Comb 1 IPI00000792.1
337 S_Total95_389 IPI00219446.4 |SWISS-PROT:P30086 |REFSEQ_NP:NP_002558 |ENSEMBL:ENSP00000261313 |H-INV:HIT000037989; HIT000041250; HIT000033915 Tax_Id=9606 Phosphatidylethanolamine-binding protein 18 EWHHFLVVNMK; LYTLVLTDPDAPSR; YVWLVYEQDR; CDEPILSNR; LYTLVLTDPDAPSRK; YVWLVYEQDRPLK; YREWHHFLVVNMK; YVWLVYEQDRPLKCDEPILSNR; VLTPTQVK; LYEQLSGK; NRPTSISWDGLDSGK; GNDISSGTVLSDYVGSGPPK; APVAGTCYQAEWDDYVPK; WSGPLSLQEVDEQPQHPLHVTYAGAAVDELGK; PTSISWDGLDSGK; GNDISSGTVLSDYVGSGPPKGTGLHR; FKVASFR; PMF; Comb 1 IPI00219446.4
338 S_Total95_428 IPI00008483.1 |SWISS-PROT:P21397 |TREMBL:Q5UL94; Q5ULA9; Q53EZ0; Q5HYP1; Q5UL91; Q5ULA3 |REFSEQ_NP:NP_000231 |ENSEMBL:ENSP00000340684 |H-INV:HIT000033623 Tax_Id=9606 Amine oxidase [flavin-containing] A 18 DIWVQEPESK; IFFAGTETATK; ELGIETYK; DVPAVEITHTFWER; FVGGSGQVSER; EIPTDAPWEAQHADKWDK; GAFPPVWNPIAYLDYNNLWR; NEHVDYVDVGGAYVGPTQNR; LLTEYGVSVLVLEAR; VLGSQEALHPVHYEEK; VTEKDIWVQEPESK; IFSVTNGGQER; YVINAIPPTLTAK; IHFRPELPAER; IMDLLGDQVK; EIPTDAPWEAQHADK; WSGYMEGAVEAGER; EVLNGLGKVTEK 1 IPI00008483.1
339 S_Total95_533 IPI00008842.1 |SWISS-PROT:Q9UBR1 |REFSEQ_NP:NP_057411 |ENSEMBL:ENSP00000324343 |H-INV:HIT000007551 Tax_Id=9606 Beta-ureidopropionase 18 AHQDFGYFYGSSYVAAPDSSR; EDFELQGYAFEAAEEQLR; IPLPANAPVAEQVSALHR; KAHQDFGYFYGSSYVAAPDSSR; LDLNLCQQVNDVWNFK; NAAIANHCFTCAINR; VGTEHFPNEFTSGDGK; EKLPWTEFAESAEDGPTTR; HLPLPDLQEVK; IAVNICYGR; LPWTEFAESAEDGPTTR; VGTEHFPNEFTSGDGKK; SNYSPTIVKE; NHDMVVVSPILER; DSEHGDVLWNTAVVISNSGAVLGK; IVHVGLVQNR; VGDFNESTYYMEGNLGHPVFQTQFGR; PMF; Comb 1 IPI00008842.1
340 S_Total95_540 IPI00329133.1 |TREMBL:Q86WU2 |REFSEQ_NP:NP_705690 |ENSEMBL:ENSP00000300051 Tax_Id=9606 LDHD protein 18 AVVGGSHVSTAAVVR; LPEIVVQTK; AVLDPQGLMNPGKVL; SAAGYNLTGLFVGSEGTLGLITATTLR; DNVLNLEVVLPDGR; HNAWYAALATR; ILELNQEDFSVVVEPGVTR; TEEIVQQNGASDFSWAK; CEPPDAVVWPQNVEQVSR; AFAEQLGR; GYSTDVCVPISR; AVLDPQGLMNPGK; LWTARHNAWYAALATR; EDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGR; LHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVAR; ALALHGTCTGEHGIGMGK; HNAWYAALATRPGCK; PMF; Comb 1 IPI00329133.1
341 S_Total95_584 IPI00448095.3 |SWISS-PROT:Q7Z4W1 |REFSEQ_NP:NP_057370 |ENSEMBL:ENSP00000303356 |H-INV:HIT000001904; HIT000030436 Tax_Id=9606 L-xylulose reductase 18 AVIQVSQIVAR; TQADLDSLVR; VMALELGPHK; GALDMLTK; GVPGAIVNVSSQCSQR; ALGSVGPVDLLVNNAAVALLQPFLEVTK; FAEVEHVVNAILFLLSDR; ECPGIEPVCVDLGDWEATER; GTVQALHATGAR; VNAVNPTVVMTSMGQATWSDPHK; SGMTTGSTLPVEGGFWAC; AVTNHSVYCSTK; RVLVTGAGK; MELFLAGRRVLVTGAGK; SFEVNLR; IRVNAVNPTVVMTSMGQATWSDPHK; TMLNRIPLGKFAEVEHVVNAILFLLSDR; PMF; Comb 1 IPI00448095.3
342 S_Total95_695 IPI00304840.3 |SWISS-PROT:P12110-1 |TREMBL:Q9BUM6; Q7LCA7; Q9Y4S8; Q6FHW5; Q6P0Q1 |REFSEQ_NP:NP_001840 |ENSEMBL:ENSP00000300527 |H-INV:HIT000024381; HIT000030930; HIT000018852 Tax_Id=9606 Splice Isoform 2C2 of Collagen alpha 2(VI) chain precursor 18 LFAVAPNQNLK; NFVINVVNR; NLQGISSFR; DYDSLAQPGFFDR; DIASTPHELYR; VFAVVITDGR; HESENLYSIACDKPQQVR; NLEWIAGGTWTPSALK; NFVINVVNRLGAIAKDPK; DVTVTAIGIGDMFHEK; NDYATMLPDSTEINQDTINR; PVDIVFLLDGSER; PGFSYPGPRGAPGEK; YGGLHFSDQVEVFSPPGSDR; QFVPQFISQLQNEFYLDQVALSWR; FIDDMEDVLCPDPQIVCPDLPCQTELSVAQCTQR; GTVHFAVVITDGHVTGSPCGGIK; Comb; PMF 1 IPI00304840.3
343 S_Total95_711 IPI00020955.1 |SWISS-PROT:P51857 |REFSEQ_NP:NP_005980 |ENSEMBL:ENSP00000242375 |H-INV:HIT000014748 Tax_Id=9606 3-oxo-5-beta-steroid 4-dehydrogenase 18 DHPEYPFHDEY; NPIWVNVSSPPLLK; SIGVSNFNR; IPLSDGNSIPIIGLGTYSEPK; HIDGAYIYQNEHEVGEAIR; HKPVSNQVECHPYFTQPK; VAIDTGYR; REDIFYCGK; FCQQHDIVITAYSPLGTSR; TAAQIVLR; DALLNSLGK; QLELILNKPGLK; ENFQIFDFSLTEEEMK; SNLCATWEAMEACK; FVELLMWR; LWATNHVPEMVRPTLER; SLGVSNFNR; PMF; Comb 1 IPI00020955.1
344 S_Total95_815 IPI00001734.2 |SWISS-PROT:Q9Y617-1 |TREMBL:Q5T7G6 |REFSEQ_NP:NP_478059 |ENSEMBL:ENSP00000277070 |H-INV:HIT000030035; HIT000038285; HIT000008734; HIT000032041 Tax_Id=9606 Splice Isoform 1 of Phosphoserine aminotransferase 18 ELLAVPDNYK; FGVIFAGAQK; LPHSVLLEIQK; QVVNFGPGPAK; ASLYNAVTIEDVQK; DDLLGFALR; ECPSVLEYK; IINNTENLVR; NVGSAGVTVVIVR; FGTINIVHPK; GVGISVLEMSHR; KFGTINIVHPK; VIFLQGGGCGQFSAVPLNLIGLK; CADYVVTGAWSAK; GAVLVCDMSSNFLSK; SQTIYEIIDNSQGFYVCPVEPQNR; ALELNMLSLK; PMF; Comb 1 IPI00001734.2
345 S_Total95_827 IPI00555812.2 |TREMBL:Q53F31; Q6LDC6; Q6GTG1 |REFSEQ_NP:NP_000574 |ENSEMBL:ENSP00000273951 Tax_Id=9606 Vitamin D-binding protein variant 18 ELSSFIDK; VPTADLEDVLPLAEDITNILSK; EDFTSLSLVLYSR; GQELCADYSENTFTEYK; KFPSGTFEQVSQLVK; SDFASNCCSINSPPLYCDSEIDAELK; SLGECCDVEDSTTCFNAK; EVVSLTEACCAEGADPDCYDTR; HQPQEFPTYVEPTNDEICEAFR; AKLPEATPTELAK; SCESNSPFPVHPGTAECCTK; VCSQYAAYGEK; CCESASEDCMAK; HLSLLTTLSNR; RTHLPEVFLSK; FPSGTFEQVSQLVK; HQPQEFPTYVEPTNDEICEAFRK; PMF; Comb 1 IPI00555812.2
346 S_Total95_921 IPI00479786.1 |TREMBL:Q5U4P6; Q59EZ9 |REFSEQ_NP:NP_003676 |ENSEMBL:ENSP00000201886 Tax_Id=9606 KHSRP protein 18 IINDLLQSLR; AINQQTGAFVEISR; GGGGPGGGGPGGGSAGGPSQPPGGGGPGIR; IGGDAATTVNNSTPDFGFGGQK; IGGGIDVPVPR; IGQQPQQPGAPPQQDYTK; LASQGDSISSQLGPIHPPPR; SVSLTGAPESVQK; VQISPDSGGLPER; DAFADAVQR; IAHIMGPPDR; MILIQDGSQNTNVDKPLR; MMLDDIVSR; VQQACEMVMDILR; HSVGVVIGR; VPDGMVGLIIGR; KLASQGDSISSQLGPIHPPPR; PMF; Comb 1 IPI00479786.1
347 S_Total95_1260 IPI00010414.3 |SWISS-PROT:O00151 |TREMBL:Q5VZH5 |REFSEQ_NP:NP_066272 |ENSEMBL:ENSP00000265995 |H-INV:HIT000038440; HIT000030002 Tax_Id=9606 PDZ and LIM domain protein 1 18 DFEQPLAISR; VWSPLVTEEGK; GHFFVEDQIYCEK; VITNQYNNPAGLYSSENISNFNNALESK; QSTSFLVLQEILESEEK; VTPPEGYEVVTVFPK; VWSPLVTEEGKR; GCTDNLTLTVAR; CGTGIVGVFVK; MNLASEPQEVLHIGSAHNR; VAASIGNAQK; HPECYVCTDCGTNLK; PLDHAQPPSSLVIDK; TAASGVEANSRPLDHAQPPSSLVIDKESEVYK; TAASGVEANSRPLDHAQPPSSLVIDK; AALANLCIGDVITAIDGENTSNMTHLEAQNR; IKGCTDNLTLTVAR; Comb; PMF 1 IPI00010414.3
348 S_Total95_1355 IPI00412522.3 |TREMBL:Q9NVA0; Q8TAN9; Q9ULD0 |REFSEQ_NP:NP_060715 |ENSEMBL:ENSP00000347141 |H-INV:HIT000004187; HIT000001006; HIT000040194; HIT000012431 Tax_Id=9606 Oxoglutarate dehydrogenase-like 18 DVVVDLVCYR; KPLIIFTPK; NITLSLVANPSHLEAVDPVVQGK; FLDTAFNLQAFEGK; GRLNVLANVIR; LIAEGTVTLQEFEEEIAK; LNVLANVIR; LAFYDLQEADLDK; LEQISPFPFDLIK; TVDWALAEYMAFGSLLK; QVPVLKKYADK; SSGPPATFPSSK; LEAADEGSGDVK; LVEDHLAVQSLIR; GHHVAQLDPLGILDADLDSFVPSDLITTIDK; EASEEAFSGSAQPRPPSVVHESR; SMTCPATGIPEDMLTHIGSVASSVPLEDFK; PMF; Comb 1 IPI00412522.3
349 S_Total95_1589 IPI00019591.1 |SWISS-PROT:P00751-1 |TREMBL:Q53F89; Q5JP67; Q5ST50 |REFSEQ_NP:NP_001701 |ENSEMBL:ENSP00000299370 |H-INV:HIT000031730; HIT000033574 Tax_Id=9606 Splice Isoform 1 of Complement factor B precursor 18 EELLPAQDIK; EAGIPEFYDYDVALIK; FIQVGVISWGVVDVCK; FLCTGGVSPYADPNTCR; PQGSCSLEGVEIK; WSGQTAICDNGAGYCSNPGIPIGTR; VSEADSSNADWVTK; YGLVTYATYPK; QLNEINYEDHK; VKDISEVVTPR; KDNEQHVFKVK; DFHINLFQVLPWLK; DISEVVTPR; LEDSVTYHCSR; PICLPCTEGTTR; IVLDPSGSMNIYLVLDGSDSIGASNFTGAK; HVIILMTDGLHNMGGDPITVIDEIR; Comb 1 IPI00019591.1
350 S_Total95_2598 IPI00007282.1 |SWISS-PROT:P05181 |TREMBL:Q6LER5; Q5VZD5; Q6NWT9; Q16868; Q6NWT7 |REFSEQ_NP:NP_000764 |ENSEMBL:ENSP00000252945 Tax_Id=9606 Cytochrome P450 2E1 18 EAHFLLEALR; EALLDYKDEFSGR; FGPVFTLYVGSQR; GTVVVPTLDSVLYDNQEFPDPEK; DLTDCLLVEMEK; FITLVPSNLPHEATR; YSDYFKPFSTGK; YSDYFKPFSTGKR; DRGIIFNNGPTWK; GIIFNNGPTWK; TQGQPFDPTFLIGCAPCNVIADILFR; FKPEHFLNENGK; DIDLSPIHIGFGCIPPR; GDLPAFHAHR; VKEHHQSLDPNCPR; QVHSSWNLPPGPFPLPIIGNLFQLELK; KTQGQPFDPTFLIGCAPCNVIADILFR; DRQEMPYMDAVVHEIQR 1 IPI00007282.1
351 S_Total95_2600 IPI00290301.1 |SWISS-PROT:P10632 |TREMBL:Q8WWB1; Q5VX93; Q9UCZ9 |REFSEQ_NP:NP_000761 |ENSEMBL:ENSP00000285985 |H-INV:HIT000038839 Tax_Id=9606 Cytochrome P450 2C8 18 DFIDCFLIK; MELFLFLTTILQNFNLK; YGLLLLLK; SHMPYTDAVVHEIQR; SEFNIENLVGTVADLFVAGTETTSTTLR; VQEEIDHVIGR; VQEEAHCLVEELR; EALIDNGEEFSGR; EHQASLDVNNPR; YSDLVPTGVPHAVTTDTK; DQNFLTLMK; ASPCDPTFILGCAPCNVICSVVFQK; ILNSPWIQVCNNFPLLIDCFPGTHNK; DNQKSEFNIENLVGTVADLFVAGTETTSTTLR; GIVSLPPSYQICFIPV; GTTIMALLTSVLHDDK; ICAGEGLAR; SVDDLKNLNTTAVTK 1 IPI00290301.1
352 S_Total95_2601 IPI00013323.4 |SWISS-PROT:P33261 |TREMBL:Q767A3; Q8WZB2; Q8WZB1; Q16743 |REFSEQ_NP:NP_000760 |ENSEMBL:ENSP00000285981 Tax_Id=9606 Cytochrome P450 2C19 18 EALIDLGEEFSGR; HFLDEGGNFK; YALLLLLK; DFIDCFLIK; QNQQSEFTIENLVITAADLLGAGTETTSTTLR; LPPGPTPLPVIGNILQIDIK; GFGIVFSNGK; YIDLIPTSLPHAVTCDVK; CLVEELRK; RFDYKDQQFLNLMEK; ICVGEGLAR; DQQFLNLMEK; GTTILTSLTSVLHDNK; NLAFMESDILEK; EKQNQQSEFTIENLVITAADLLGAGTETTSTTLR; ASPCDPTFILGCAPCNVICSIIFQK; IVSTPWIQICNNFPTIIDYFPGTHNK; EFPNPEMFDPRHFLDEGGNFK 1 IPI00013323.4
353 S_Total95_2645 IPI00383237.3 |TREMBL:Q9UK31; Q9NYI7; Q9UKK4 |ENSEMBL:ENSP00000334983 Tax_Id=9606 Pyruvate kinase M2 18 GDLGIEIPAEK; AEGSDVANAVLDGADCIMLSGETAK; AGKPVICATQMLESMIK; DPVQEAWAEDVDLR; GDLGIEIPAEKVFLAQK; GVNLPGAAVDLPAVSEK; KGVNLPGAAVDLPAVSEK; FDEILEASDGIMVAR; KGVNLPGAAVDLPAVSEKDIQDLK; CCSGAIIVLTK; IYVDDGLISLQVK; LDIDSPPITAR; TATESFASDPILYRPVAVALDTK; GADFLVTEVENGGSLGSK; NTGIICTIGPASR; TATESFASDPILYR; LNFSHGTHEYHAETIK; LAPITSDPTEATAVGAVEASFK 1 IPI00383237.3
354 S_Total95_2694 IPI00220991.2 |SWISS-PROT:P63010-2 |TREMBL:Q96EL6; Q68DI0 |ENSEMBL:ENSP00000314414 |H-INV:HIT000032665 Tax_Id=9606 Splice Isoform 2 of Adapter-related protein complex 2 beta 1 subunit 18 LSHANSAVVLSAVK; LASQANIAQVLAELK; NINLIVQK; DCEDPNPLIR; EYATEVDVDFVR; NVEGQDMLYQSLK; ITEYLCEPLR; MEPLNNLQVAVK; LAPPLVTLLSGEPEVQYVALR; LQNNNVYTIAK; APEVSQYIYQVYDSILK; DIPNENELQFQIK; MERQVFLATWK; YESIIATLCENLDSLDEPDAR; DVSSLFPDVVNCMQTDNLELK; IQPGNPNYTLSLK; IDNADELLESFLEGFHDESTQVQLTLLTAIVK; KPSETQELVQQVLSLATQDSDNPDLR 2 IPI00333383.2, IPI00220991.2
355 S_Total95_2733 IPI00008867.1 |SWISS-PROT:P54840 |REFSEQ_NP:NP_068776 |ENSEMBL:ENSP00000261195 Tax_Id=9606 Glycogen [starch] synthase, liver 18 TNNFNVETLK; VGGIYTVIQTK; FHVELTSPPTTEGFK; GADIFLESLSR; SPFSLSHVPHGK; TQVEQCEPVNDAVR; YLCAANIDFYNHLDK; KQLWDVAHSVK; LSDLLDWR; LPIATIFTTHATLLGR; SPDDSCNQLTK; VILHPEFLSSTSPLLPMDYEEFVR; FRSPDDSCNQLTK; GEIPDLNDILDRDDLTIMK; TTADEWGENYFLIGPYFEHNMK; QSLPPVTTHNMIDDSTDPILSTIR; GDLWEACSVGIPYHDR; KPDVVTPNGLNVKK 1 IPI00008867.1
356 S_Total95_3020 IPI00007935.2 |SWISS-PROT:Q96HC4 |TREMBL:Q5UW38; Q9P1D1 |REFSEQ_NP:NP_006448 |ENSEMBL:ENSP00000321746 |H-INV:HIT000033936 Tax_Id=9606 Enigma homolog 18 KILGEVINALK; ANNSQEPSPQLASSVASTR; GALYCELCYEK; GPFLVALGK; KANNSQEPSPQLASSVASTR; YTEFYHVPTHSDASK; ILAQITGTEHLK; PGVTSLTTAAAFK; PGVTSLTTAAAFKPVGSTGVIK; DFNMPLTISSLK; ASAAPKPEPVPVQK; GCTGSLNMTLQR; IGDVVLSIDGINAQGMTHLEAQNK; QPTVTSVCSETSQELAEGQR; EVVKPVPITSPAVSK; PVPITSPAVSKVTSTNNMAYNKAPR; ASAAPKPEPVPVQKGEPK; ISNSAAYSGSVAPANSALGQTQPSDQDTLVQR 1 IPI00007935.2
357 S_Total95_3096 IPI00007928.4 |SWISS-PROT:Q6P2Q9 |TREMBL:Q53GM6; Q6JH02; Q6JH03 |REFSEQ_NP:NP_006436 |ENSEMBL:ENSP00000304350 |H-INV:HIT000014640 Tax_Id=9606 Pre-mRNA processing splicing factor 8 18 YMPHAVLK; AFFTSKALNMAIPGGPK; AISAANLHLR; EAVVNTQELLDLLVK; NNVNVASLTQSEIR; SRFGNAFHLCREVLR; WNTALIGLMTYFR; EQSQLTATQTRTVNK; GTYFPTWEGLFWEK; SQEPLPDDDEEFELPEFVEPFLK; TAEEVAALIR; AAVMHDILDMMPEGIK; DINLQDEDWNEFNDINK; EHCPAGQPVKVRVSYQK; TDMIQALGGVEGILEHTLFK; IHESIVMDLCQVFDQELDALEIETVQK; LANQLLTDLVDDNYFYLFDLK; LGNVDAFQLADGLQYIFAHVGQLTGMYR 1 IPI00007928.4
358 S_Total95_3185 IPI00031008.1 |SWISS-PROT:P24821-1 |TREMBL:Q5T7S3 |REFSEQ_NP:NP_002151 |ENSEMBL:ENSP00000265131 Tax_Id=9606 Splice Isoform 1 of Tenascin precursor 18 GHEHSIQFAEMK; FTTDLDSPR; GHEHSIQFAEMKLR; TVSGNTVEYALTDLEPATEYTLR; EQCTAGAGCCLQPATGR; ETFTTGLDAPR; LEELENLVSSLR; TTLTGLRPGTEYGIGVSAVK; VATYLPAPEGLK; SSTITAKFTTDLDSPR; DTDSAITNCALSYK; LPVGSQCSVDLESASGEK; CICNEGYSGEDCSEVSPPK; DLTATEVQSETALLTWR; GLEPGQEYNVLLTAEK; RGDMSSNPAKETFTTGLDAPR; VPGDQTSTIIQELEPGVEYFIR; MGAMTQLLAGVFLAFLALATEGGVLKKVIR 6 IPI00031008.1, IPI00220211.1, IPI00220212.1, IPI00220213.1, IPI00220214.1, IPI00220216.1
359 S_Total95_3357 IPI00221224.4 |SWISS-PROT:P15144 |TREMBL:Q8IVL7; Q71E46; Q6GT90; Q9UCE0; Q59E93 |REFSEQ_NP:NP_001141 |ENSEMBL:ENSP00000300060 Tax_Id=9606 Aminopeptidase N 18 ENSLLFDPLSSSSSNK; EVVLQWFTENSK; FSTEYELQQLEQFK; AQIINDAFNLASAHK; DNEETGFGSGTR; YLSYTLNPDLIR; VVATTQMQAADAR; GVGGSQPPDIDK; QYMPWEAALSSLSYFK; EATDVIIIHSK; LFNDYGGGSFSFSNLIQAVTR; VNYDEENWR; YRLPNTLKPDSYQVTLR; DSQYEMDSEFEGELADDLAGFYR; KVVATTQMQAADAR; MLSSFLSEDVFK; KQVTPLFIHFR; VMAVDALASSHPLSTPASEINTPAQISELFDAISYSK 1 IPI00221224.4
360 S_Total95_3453 IPI00017292.1 |SWISS-PROT:P35222-1 |REFSEQ_NP:NP_001895 |ENSEMBL:ENSP00000344456 |H-INV:HIT000023302 Tax_Id=9606 Splice Isoform 1 of Beta-catenin 18 VAAGVLCELAQDK; LVQNCLWTLR; MEEIVEGCTGALHILAR; EAAEAIEAEGATAPLTELLHSR; LLNDEDQVVVNK; NEGVATYAAAVLFR; NLALCPANHAPLR; AGDREDITEPAICALR; HAVVNLINYQDDAELATR; LIILASGGPQALVNIMR; EDITEPAICALR; TMQNTNDVETAR; CTAGTLHNLSHHR; GLNTIPLFVQLLYSPIENIQR; RTSMGGTQQQFVEGVR; LLHPPSHWPLIK; AAVSHWQQQSYLDSGIHSGATTTAPSLSGK; AAMFPETLDEGMQIPSTQFDAAHPTNVQR 1 IPI00017292.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home