Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
361 S_Total95_3741 IPI00026665.1 |SWISS-PROT:P47897 |TREMBL:Q53HS0; Q9BUZ3; Q96AW5; Q9H3A5 |REFSEQ_NP:NP_005042 |ENSEMBL:ENSP00000307567 |H-INV:HIT000030640; HIT000013429; HIT000040862; HIT000030494; HIT000037607; HIT000029583 Tax_Id=9606 Glutaminyl-tRNA synthetase 18 EAATQAQQTLGSTIDK; ECGVGVIVTPEQIEEAVEAAINR; GFHQVPFAPIVFIER; ILQLVATGAVR; LGYFSVDPDSHQGK; SHPLDPIDTVDFER; SLDIQVPNFPADETK; ATGILLYGLASR; AFIHWVSQPLMCEVR; LNLHYAVVSK; VTYASDYFDQLYAWAVELIR; LAWGQPVGLR; FSEGEATLR; DVVENGETADQTLSLMEQLR; GPSGCVESLEVTCR; NEVDMQVLHLLGPK; VIITNFPAAK; NPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAK 1 IPI00026665.1
362 S_Total95_3805 IPI00016621.5 |SWISS-PROT:O94973 |TREMBL:Q53ET1; Q9UFK5 |REFSEQ_NP:NP_036437 |ENSEMBL:ENSP00000327694 |H-INV:HIT000024776; HIT000010912; HIT000032639; HIT000011163; HIT000000616 Tax_Id=9606 Adapter-related protein complex 2 alpha 2 subunit 18 FVNLFPEVKPTIQDVLR; GLAVFISDIR; THIETVINALK; ACNQLGQFLQHR; LTECLETILNK; NNGVLFENQLLQIGLK; NPTFMGLALHCIASVGSR; TTQIGCLLR; YGGTFQNVSVQLPITLNK; QLSNPQQEVQNIFK; LLQCYPPPDPAVR; VGGYILGEFGNLIAGDPR; TSVSLAVSR; FFQPTEMASQDFFQR; GPSTVTDLEDTK; NAVLFEAISLIIHHDSEPNLLVR; IIGFGSALLEEVDPNPANFVGAGIIHTK; LSTVASTDILATVLEEMPPFPER 1 IPI00016621.5
363 S_Total95_4721 IPI00294739.1 |SWISS-PROT:Q9Y3Z3 |TREMBL:Q59H15; Q8N491; Q5JXG8 |REFSEQ_NP:NP_056289 |ENSEMBL:ENSP00000262878 |H-INV:HIT000024110; HIT000011083 Tax_Id=9606 SAM domain and HD domain-containing protein 1 18 FENLGVSSLGER; NPIDHVSFYCK; NQVSQLLPEK; QYFVQWCADR; TWGPEQVCSFLR; ADDYIEITGAGGK; ENEITGALLPCLDESR; YVGETQPTGQIK; IIDTPQFQR; VGNIIDTMITDAFLK; EWNDSTSVQNPTR; FAEQLIR; LTDNIFLEILYSTDPK; LTDNIFLEILYSTDPKLK; SFLYEIVSNK; VINDPIHGHIELHPLLVR; NQVSQLLPEKFAEQLIRVYCK; TPSNTPSAEADWSPGLELHPDYK 1 IPI00294739.1
364 S_Total95_3 IPI00011229.1 |SWISS-PROT:P07339 |TREMBL:Q6IB57 |REFSEQ_NP:NP_001900 |ENSEMBL:ENSP00000236671 |H-INV:HIT000037529 Tax_Id=9606 Cathepsin D precursor 17 DPDAQPGGELMLGGTDSK; ISVNNVLPVFDNLMQQK; LVDQNIFSFYLSR; AIGAVPLIQGEYMIPCEK; EGCEAIVDTGTSLMVGPVDEVR; LLDIACWIHHK; FDGILGMAYPR; VGFAEAAR; YSQAVPAVTEGPIPEVLK; VSTLPAITLK; AYWQVHLDQVEVASGLTLCK; VSTLPAITLKLGGK; YYTVFDR; QVFGEATKQPGITFIAAK; LSPEDYTLK; YYTVFDRDNNR; PMF; Comb 1 IPI00011229.1
365 S_Total95_4 IPI00023704.1 |TREMBL:Q93052 |REFSEQ_NP:NP_005569 |ENSEMBL:ENSP00000318089 |H-INV:HIT000028083 Tax_Id=9606 LPP 17 TYITDPVSAPCAPPLQPK; YYEGYYAAGPGYGGR; MVIPNQPPLTATK; AYCEPCYINTLEQCNVCSK; KTYITDPVSAPCAPPLQPK; STGEPLGHVPAR; EPGYTPPGAGNQNPPGMYPVTGPK; GGMDYAYIPPPGLQPEPGYGYAPNQGR; METTHSFGNPSISVSTQQPPK; NDSDPTYGQQGHPNTWK; PTFNVQVK; CEDCGGLLSEGDNQGCYPLDGHILCK; GGHSGQLGPSSVAPSFRPEDELEHLTK; PRPPQSSTGSTASPPVSTPVTGHK; REPGYTPPGAGNQNPPGMYPVTGPK; STLKPQPAPQAGPIPVAPIGTLK; Comb; PMF 1 IPI00023704.1
366 S_Total95_28 IPI00012007.5 |SWISS-PROT:P23526 |TREMBL:Q9H4U6; Q9BZ13 |REFSEQ_NP:NP_000678 |ENSEMBL:ENSP00000217426 |H-INV:HIT000022464; HIT000035325; HIT000034741 Tax_Id=9606 Adenosylhomocysteinase 17 KLDEAVAEAHLGK; VADIGLAAWGR; VAVVAGYGDVGK; VPAINVNDSVTK; GISEETTTGVHNLYK; DGPLNMILDDGGDLTNLIHTK; YPQLLPGIR; AGIPVYAWK; IILLAEGR; SKFDNLYGCR; FDNLYGCR; WLNENAVEK; LDEAVAEAHLGK; ALDIAENEMPGLMR; YPVGVHFLPK; VNIKPQVDR; Comb; PMF 1 IPI00012007.5
367 S_Total95_41 IPI00013683.2 |SWISS-PROT:Q13509 |TREMBL:Q9BV28 |REFSEQ_NP:NP_006077 |ENSEMBL:ENSP00000320295 |H-INV:HIT000029891 Tax_Id=9606 Tubulin beta-3 chain 17 NSSYFVEWIPNNVK; GHYTEGAELVDSVLDVVR; LAVNMVPFPR; AILVDLEPGTMDSVR; EIVHIQAGQCGNQIGAK; ISEQFTAMFR; FPGQLNADLR; NMMAACDPR; KLAVNMVPFPR; MREIVHIQAGQCGNQIGAK; EIVHLQAGQCGNQIGAK; ALTVPELTQQMFDAK; IMNTFSVVPSPK; MSSTFIGNSTAIQELFK; LHFFMPGFAPLTAR; MSSTFIGNSTAIQELFKR; PMF 1 IPI00013683.2
368 S_Total95_52 IPI00216644.3 |SWISS-PROT:P08263 |TREMBL:Q5GHF8; Q5SZC1 |REFSEQ_NP:NP_665683 |ENSEMBL:ENSP00000335620 Tax_Id=9606 Glutathione S-transferase A1 17 WLLAAAGVEFEEK; AILNYIASK; YFPAFEK; ISNLPTVK; SAEDLDKLR; KFLQPGSPR; NDGYLMFQQVPMVEIDGMK; SHGQDYLVGNK; ADIHLVELLYYVEELDSSLISSFPLLK; AILNYIASKYNLYGK; SHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLK; SHGQDYLVGNKLSR; FLQPGSPR; ISNLPTVKK; ALIDMYIEGIADLGEMILLLPVCPPEEK; PMF; Comb; LHYFNAR 1 IPI00216644.3
369 S_Total95_67 IPI00305383.1 |SWISS-PROT:P22695 |REFSEQ_NP:NP_003357 |ENSEMBL:ENSP00000268379 |H-INV:HIT000031456; HIT000017973; HIT000029668; HIT000018863 Tax_Id=9606 Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor 17 NALANPLYCPDYR; TIAQGNLSNTDVQAAK; LPNGLVIASLENYSPVSR; MALIGLGVSHPVLK; RWEVADLQPQLK; YEDFSNLGTTHLLR; ATAAPAGAPPQPQDLEFTK; ENMAYTVECLR; WEVADLQPQLK; GASSFKITRGIEAVGGK; QVAEQFLNMR; AVAFQNPQTHVIENLHAAAYR; ATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIK; VTSEELHYFVQNHFTSAR; EQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVK; RGSNTTSHLHQAVAK; PMF; Comb 1 IPI00305383.1
370 S_Total95_111 IPI00030154.1 |SWISS-PROT:Q06323 |TREMBL:Q6IBM2; Q6FHU3 |REFSEQ_NP:NP_006254 |ENSEMBL:ENSP00000206451 |H-INV:HIT000029544; HIT000033257 Tax_Id=9606 Proteasome activator complex subunit 1 17 NAYAVLYDIILK; APLDIPVPDPVK; EPALNEANLSNLK; IEDGNNFGVAVQEK; QLVHELDEAEYR; TENLLGSYFPK; APLDIPVPDPVKEK; DVIEQLNLVTTWLQLQIPR; ISELDAFLKEPALNEANLSNLK; ISELDAFLK; LEGFHTQISK; GPPCGPVNCNEK; VFELMTSLHTK; GEDEDKGPPCGPVNCNEK; KGEDEDKGPPCGPVNCNEK; VQPEAQAKVDVFR; PMF; Comb 1 IPI00030154.1
371 S_Total95_132 IPI00384116.2 |TREMBL:Q86U01 |REFSEQ_NP:NP_001018083 Tax_Id=9606 Mitochondrial phosphoenolpyruvate carboxykinase 2 isoforM 2 precursor 17 VLSGDLGQLPTGIR; TVIVTPSQR; GQLGNWMSPADFQR; EIISFGSGYGGNSLLGK; LGTPVLQALGDGDFVK; TLIGHVPDQR; YNNCWLAR; CLHSVGQPLTGQGEPVSQWPCNPEK; IGVQLTDSAYVVASMR; VECVGDDIAWMR; DEGWLAEHMLILGITSPAGK; EIISFGSGYGGNSLLGKK; FPGCMKGR; LCQPEGIHICDGTEAENTATLTLLEQQGLIR; YVAAAFPSACGK; VLSGDLGQLPTGIRDFVEHSAR; PMF; Comb 1 IPI00384116.2
372 S_Total95_138-1 IPI00385244.4 |SWISS-PROT:P18669 |TREMBL:Q6FHU2 |REFSEQ_NP:NP_002620 |ENSEMBL:ENSP00000351067; ENSP00000306191 |H-INV:HIT000034757 Tax_Id=9606 Phosphoglycerate mutase 1 17 VLIAAHGNSLR; HYGGLTGLNK; ALPFWNEEIVPQIK; FSGWYDADLSPAGHEEAK; YADLTEDQLPSCESLK; FSGWYDADLSPAGHEEAKR; YADLTEDQLPSCESLKDTIAR; NLKPIKPMQFLGDEETVR; DAGYEFDICFTSVQK; RVLIAAHGNSLR; HGESAWNLENR; TLWTVLDAIDQMWLPVVR; AMEAVAAQGK; PMQFLGDEETVR; SYDVPPPPMEPDHPFYSNISK; HLEGLSEEAIMELNLPTGIPIVYELDK; PMF; Comb 1 IPI00385244.4
373 S_Total95_138-2 IPI00549725.3 |TREMBL:Q53G35; Q6P6D7; Q6FHK8 |H-INV:HIT000035367 Tax_Id=9606 Phosphoglycerate mutase 1 17 VLIAAHGNSLR; HYGGLTGLNK; ALPFWNEEIVPQIK; FSGWYDADLSPAGHEEAK; YADLTEDQLPSCESLK; FSGWYDADLSPAGHEEAKR; YADLTEDQLPSCESLKDTIAR; NLKPIKPMQFLGDEETVR; DAGYEFDICFTSVQK; RVLIAAHGNSLR; HGESAWNLENR; TLWTVLDAIDQMWLPVVR; AMEAVAAQGK; PMQFLGDEETVR; SYDVPPPPMEPDHPFYSNISK; HLEGLSEEAIMELNLPTGIPIVYELDK; PMF; Comb 1 IPI00549725.3
374 S_Total95_153-1 IPI00550188.3 |TREMBL:Q6IB06; Q53EW8 |H-INV:HIT000003337; HIT000034836 Tax_Id=9606 Thiosulfate sulfurtransferase variant 17 KVDLSQPLIATCR; TYEQVLENLESK; VLDASWYSPGTR; FQLVDSR; VDLSQPLIATCR; EGHPVTSEPSRPEPAVFK; FLGTEPEPDAVGLDSGHIR; TYEQVLENLESKR; HVPGASFFDIEECR; GAVNMPFMDFLTEDGFEK; LGISNHTHVVVYDGEHLGSFYAPR; PDVAVYDGSWSEWFR; TVSVLNGGFR; RFQLVDSR; DTASPYEMMLPSEAGFAEYVGR; VHQVLYR; PMF; Comb 1 IPI00550188.3
375 S_Total95_153-2 IPI00216293.5 |SWISS-PROT:Q16762 |REFSEQ_NP:NP_003303 |ENSEMBL:ENSP00000345812; ENSP00000249042 |H-INV:HIT000016741 Tax_Id=9606 Thiosulfate sulfurtransferase 17 KVDLSQPLIATCR; TYEQVLENLESK; VLDASWYSPGTR; FQLVDSR; VDLSQPLIATCR; EGHPVTSEPSRPEPAVFK; FLGTEPEPDAVGLDSGHIR; TYEQVLENLESKR; HVPGASFFDIEECR; GAVNMPFMDFLTEDGFEK; LGISNHTHVVVYDGEHLGSFYAPR; PDVAVYDGSWSEWFR; TVSVLNGGFR; RFQLVDSR; DTASPYEMMLPSEAGFAEYVGR; VHQVLYR; PMF; Comb 1 IPI00216293.5
376 S_Total95_180 IPI00550724.3 |H-INV:HIT000037462 Tax_Id=9606 Actin, cytoplasmic 1 17 DLTDYLMK; EITALAPSTMK; IWHHTFYNELR; GYSFTTTAER; SYELPDGQVITIGNER; AVFPSIVGRPR; DLYANTVLSGGTTMYPGIADR; LCYVALDFEQEMATAASSSSLEK; QEYDESGPSIVHR; TTGIVMDSGDGVTHTVPIYEGYALPHAILR; AGFAGDDAPR; LDLAGRDLTDYLMK; AVFPSIVGR; KDLYANTVLSGGTTMYPGIADR; VPPEEHPVLLTEAPLNPK; QEYDESGPSIVHRK; PMF; Comb 1 IPI00550724.3
377 S_Total95_237 IPI00303174.1 |SWISS-PROT:Q93099 |TREMBL:Q8WW71 |REFSEQ_NP:NP_000178 |ENSEMBL:ENSP00000344379; ENSP00000283871 |H-INV:HIT000038963 Tax_Id=9606 Homogentisate 1,2-dioxygenase 17 DFLIPIAWYEDR; GNLLIYTEFGK; QVPGGYTVINK; CFYNSDGDFLIVPQK; FSIDVFEETR; KVDFVSGLHTLCGAGDIK; SVRPGVAIADFVIFPPR; TFRPPYYHR; VDFVSGLHTLCGAGDIK; YISGFGNECSSEDPR; QDVSPFNVVAWHGNYTPYK; MLVQPNEICVIQR; GYILEVYGVHFELPDLGPIGANGLANPR; PGVAIADFVIFPPR; NCMSEFMGLIR; NFMVINSVAFDHADPSIFTVLTAK; PMF; Comb 1 IPI00303174.1
378 S_Total95_275 IPI00291483.3 |SWISS-PROT:P42330 |TREMBL:Q9UKL9; Q5T2L1; Q9UII3 |REFSEQ_NP:NP_003730 |ENSEMBL:ENSP00000318831 |H-INV:HIT000030442; HIT000042170; HIT000038564 Tax_Id=9606 Aldo-keto reductase family 1 member C3 17 SIGVSNFNR; REDIFYTSK; TPALIALR; EDIFYTSK; QLEMILNKPGLK; RTPALIALR; RQLEMILNKPGLK; LAIEAGFR; WVDPNSPVLLEDPVLCALAK; DIVLVAYSALGSQR; HIDSAHLYNNEEQVGLAIR; NLHYFNSDSFASHPNYPYSDEY; SKDIVLVAYSALGSQR; LNDGHFMPVLGFGTYAPPEVPR; VIFDIVDLCTTWEAMEK; YKPVCNQVECHPYFNR; PMF; Comb 1 IPI00291483.3
379 S_Total95_308 IPI00017551.1 |SWISS-PROT:Q15493 |TREMBL:Q53FC9; Q5JRR5 |REFSEQ_NP:NP_004674; NP_690608 |ENSEMBL:ENSP00000338400; ENSP00000253303 Tax_Id=9606 Senescence marker protein-30 17 IECVLPENCR; YFAGTMAEETAPAVLER; EQSAVVLATVDNDKK; CGESPVWEEVSNSLLFVDIPAK; FCALNWK; HQGALYSLFPDHHVK; YFDQVDISNGLDWSLDHK; EEQIPDGMCIDAEGK; LWVACYNGGR; VTMDAPVSSVALR; EQSAVVLATVDNDK; LEKEEQIPDGMCIDAEGK; QSGGYVATIGTK; DGMDPEGLLR; CGESPVWEEVSNSLLFVDIPAKK; QPEAGGIFK; PMF; Comb 1 IPI00017551.1
380 S_Total95_313 IPI00000874.1 |SWISS-PROT:Q06830 |REFSEQ_NP:NP_002565; NP_859048; NP_859047 |ENSEMBL:ENSP00000262746 |H-INV:HIT000033022; HIT000039247 Tax_Id=9606 Peroxiredoxin 1 17 GLFIIDDK; GLFIIDDKGILR; LVQAFQFTDK; ATAVMPDGQFK; QITVNDLPVGR; QGGLGPMNIPLVSDPK; TIAQDYGVLK; HGEVCPAGWKPGSDTIKPDVQK; RTIAQDYGVLK; ADEGISFR; KQGGLGPMNIPLVSDPK; DISLSDYK; LNCQVIGASVDSHFCHLAWVNTPK; PGSDTIKPDVQK; TIAQDYGVLKADEGISFR; IGHPAPNFK; PMF; Comb 1 IPI00000874.1
381 S_Total95_322 IPI00031557.2 |SWISS-PROT:P32929-1 |TREMBL:Q53FB3; Q53Y79 |REFSEQ_NP:NP_001893 |ENSEMBL:ENSP00000235407 |H-INV:HIT000037338 Tax_Id=9606 Splice Isoform 1 of Cystathionine gamma-lyase 17 AVVPPISLSTTFK; LLEAAITPETK; DVLGISDTLIR; QVASEFGLK; LSVGLEDEEDLLEDLDQALK; FLQNSLGAVPSPIDCYLCNR; NDRDVLGISDTLIR; VIYPGLPSHPQHELVK; YCLAFASGLAATVTITHLLK; IKLLEAAITPETK; NGMAVAQFLESNPWVEK; GTLQHAEIFLK; AGDQIICMDDVYGGTNR; LFTLAESLGGFESLAELPAIMTHASVLK; QGAPGQHSGFEYSR; LVWIETPTNPTQK; Comb; PMF 1 IPI00031557.2
382 S_Total95_368-1 IPI00215901.1 |SWISS-PROT:P54819-1 |TREMBL:Q5TIF7 |REFSEQ_NP:NP_001616 |ENSEMBL:ENSP00000354744 |H-INV:HIT000034341 Tax_Id=9606 Adenylate kinase 2 17 AVLLGPPGAGK; EKLDSVIEFSIPDSLLIR; GIHSAIDASQTPDVVFASILAAFSK; LDSVIEFSIPDSLLIR; LVSDEMVVELIEK; NGFLLDGFPR; LAENFCVCHLATGDMLR; LQAYHTQTTPLIEYYR; AMVASGSELGK; EPMKDDITGEPLIR; QAEMLDDLMEK; SYHEEFNPPK; SYHEEFNPPKEPMK; SYHEEFNPPKEPMKDDITGEPLIR; AVLLGPPGAGKGTQAPR; APSVPAAEPEYPK; PMF; Comb 1 IPI00215901.1
383 S_Total95_368-2 IPI00218988.2 |SWISS-PROT:P54819-2 |TREMBL:Q5TIF8 |REFSEQ_NP:NP_037543 |ENSEMBL:ENSP00000234594 Tax_Id=9606 Adenylate kinase 2, isoform b 17 AVLLGPPGAGK; EKLDSVIEFSIPDSLLIR; GIHSAIDASQTPDVVFASILAAFSK; LDSVIEFSIPDSLLIR; LVSDEMVVELIEK; NGFLLDGFPR; LAENFCVCHLATGDMLR; LQAYHTQTTPLIEYYR; AMVASGSELGK; EPMKDDITGEPLIR; QAEMLDDLMEK; SYHEEFNPPK; SYHEEFNPPKEPMK; SYHEEFNPPKEPMKDDITGEPLIR; AVLLGPPGAGKGTQAPR; APSVPAAEPEYPK; PMF; Comb 1 IPI00218988.2
384 S_Total95_400 IPI00017726.1 |SWISS-PROT:Q99714-1 |TREMBL:Q6IBS9 |REFSEQ_NP:NP_004484 |ENSEMBL:ENSP00000168216 |H-INV:HIT000029562 Tax_Id=9606 Splice Isoform 1 of 3-hydroxyacyl-CoA dehydrogenase type II 17 VDVAVNCAGIAVASK; GVIINTASVAAFEGQVGQAAYSASK; LVGQGASAVLLDLPNSGGEAQAK; GGIVGMTLPIAR; GLVAVITGGASGLGLATAER; GQTHTLEDFQR; KLGNNCVFAPADVTSEK; LGDPAEYAHLVQAIIENPFLNGEVIR; LVAGEMGQNEPDQGGQR; VCNFLASQVPFPSR; VLDVNLMGTFNVIR; DVQTALALAK; LGNNCVFAPADVTSEK; LGNNCVFAPADVTSEKDVQTALALAK; KGQTHTLEDFQR; VMTIAPGLFGTPLLTSLPEK; PMF; Comb 1 IPI00017726.1
385 S_Total95_444 IPI00419802.1 |TREMBL:Q92931; Q53TC6; Q53GA8; Q53GF2; Q6NVY1 |REFSEQ_NP:NP_055177 |ENSEMBL:ENSP00000352706 Tax_Id=9606 3-hydroxyisobutyryl-Coenzyme A hydrolase, isoform 1 17 EVTEEDLNNHFK; ENIASVLENYHTESK; GCTGVITLNRPK; LAMLEEDLLALK; TLQEVLTMEYR; WEQDPETFLIIIK; AGIATHFVDSEK; AVLIDKDQSPK; SLGSSDLKF; KGCTGVITLNRPK; MSPTSLKITLRQLMEGSSK; SFILEEHMDK; INSCFSANTVEEIIENLQQDGSSFALEQLK; LGYFLALTGFR; CLFAMPETAIGLFPDVGGGYFLPR; GHDFHEGVR; PMF; Comb 1 IPI00419802.1
386 S_Total95_479 IPI00419384.1 |REFSEQ_NP:NP_002734 |ENSEMBL:ENSP00000252455 Tax_Id=9606 Protein kinase C substrate 80K-H isoform 1 17 LIELQAGK; LWEEQLAAAK; AQQEQELAADAFK; MPPYDEQTQAFIDAAQEAR; SEALPTDLPAPSAPDLTEPK; SLEDQVEMLR; YEQGTGCWQGPNR; VNDGVCDCCDGTDEYNSGVICENTCK; SLEDQVEMLRTVK; ETMVTSTTEPSR; ILIEDWK; ESLQQMAEVTR; LCPFKLVSQKPK; GVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCK; LGGSPTSLGTWGSWIGPDHDK; CEYLMELMTPAACPEPPPEAPTEDDHDEL; Comb; PMF 2 IPI00026154.1, IPI00419384.1
387 S_Total95_556 IPI00017334.1 |SWISS-PROT:P35232 |TREMBL:Q6FHP5; Q6PUJ7; Q53FV0 |REFSEQ_NP:NP_002625 |ENSEMBL:ENSP00000300408 |H-INV:HIT000036250 Tax_Id=9606 Prohibitin 17 IFTSIGEDYDER; DLQNVNITLR; EFTEAVEAK; NVPVITGSK; VLPSITTEILK; FDAGELITQR; ILFRPVASQLPR; AAELIANSLATAGDGLIELR; AATFGLILDDVSLTHLTFGK; FGLALAVAGGVVNSALYNVDAGHR; NITYLPAGQSVLLQLPQ; KLEAAEDIAYQLSR; LEAAEDIAYQLSR; GVQDIVVGEGTHFLIPWVQK; VFESIGKFGLALAVAGGVVNSALYNVDAGHR; GVQDIVVGEGTHFLIPWVQKPIIFDCR; PMF; Comb 1 IPI00017334.1
388 S_Total95_660 IPI00010740.1 |SWISS-PROT:P23246-1 |TREMBL:Q5SZ71; Q9BSV4; Q86VG2 |REFSEQ_NP:NP_005057 |ENSEMBL:ENSP00000263532 Tax_Id=9606 Splice Isoform Long of Splicing factor, proline-and glutamine-rich 17 LFVGNLPADITEDEFK; NLSPYVSNELLEEAFSQFGPIER; PVIVEPLEQLDDEDGLPEK; CSEGVFLLTTTPR; VRFATHAAALSVR; SEEKISDSEGFKANLSLLR; YGEPGEVFINK; PGGGPGLSTPGGHPKPPHR; FAQHGTFEYEYSQR; MEELHNQEMQK; MGGGGAMNMGDPYGSGGQK; SPPPGMGLNQNR; DKLESEMEDAYHEHQANLLR; RMEELHNQEMQK; FGQGGAGPVGGQGPR; GMGPGTPAGYGR; Comb; PMF 1 IPI00010740.1
389 S_Total95_696 IPI00220613.3 |SWISS-PROT:P12110-2 |TREMBL:Q14048 |REFSEQ_NP:NP_478054 |ENSEMBL:ENSP00000312529 Tax_Id=9606 Splice Isoform 2C2A of Collagen alpha 2(VI) chain precursor 17 LFAVAPNQNLK; NFVINVVNR; NLQGISSFR; DIASTPHELYR; VFAVVITDGR; HESENLYSIACDKPQQVR; NLEWIAGGTWTPSALK; NFVINVVNRLGAIAKDPK; DVTVTAIGIGDMFHEK; NDYATMLPDSTEINQDTINR; PGFSYPGPRGAPGEK; YGGLHFSDQVEVFSPPGSDR; QFVPQFISQLQNEFYLDQVALSWR; GTVHFAVVITDGHVTGSPCGGIK; TEEGPDATFPR; DIVGDPETALALC; Comb 1 IPI00220613.3
390 S_Total95_809 IPI00021716.1 |SWISS-PROT:P29401 |TREMBL:Q6MZE3; Q53EM5 |REFSEQ_NP:NP_001055 |ENSEMBL:ENSP00000296289 |H-INV:HIT000034704; HIT000018534 Tax_Id=9606 Transketolase 17 ILATPPQEDAPSVDIANIR; LDNLVAILDINR; SVPTSTVFYPSDGVATEK; VLDPFTIKPLDR; TSRPENAIIYNNNEDFQVGQAK; TVPFCSTFAAFFTR; VLDPFTIKPLDRK; LGQSDPAPLQHQMDIYQK; NSTFSEIFKK; ISSDLDGHPVPK; NMAEQIIQEIYSQIQSK; ESWHGKPLPK; NSTFSEIFK; SKDDQVTVIGAGVTLHEALAAAELLK; DDQVTVIGAGVTLHEALAAAELLK; CEAFGWHAIIVDGHSVEELCK; PMF; Comb 1 IPI00021716.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home