Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
391 S_Total95_869 IPI00465439.4 |SWISS-PROT:P04075 |TREMBL:Q6FI10; Q9UCN2; Q9BWD9 |REFSEQ_NP:NP_908932; NP_908930; NP_000025 |ENSEMBL:ENSP00000320187; ENSP00000336927 |H-INV:HIT000035037; HIT000037691; HIT000023608; HIT000036307; HIT000036009; HIT000037379; HIT000009851 Tax_Id=9606 Fructose-bisphosphate aldolase A 17 ALQASALKAWGGK; GILAADESTGSIAK; LQSIGTENTEENR; PWALTFSYGR; GVVPLAGTNGETTTQGLDGLSER; KELSDIAHRIVAPGK; QLLLTADDR; YTPSGQAGAAASESLFVSNHAY; ALANSLACQGK; FSHEEIAMATVTALR; ALSDHHIYLEGTLLKPNMVTPGHACTQK; YASICQQNGIVPIVEPEILPDGDHDLKR; YASICQQNGIVPIVEPEILPDGDHDLK; TVPPAVTGITFLSGGQSEEEASINLNAINK; ADDGRPFPQVIK; PYQYPALTPEQK; PMF; Comb 1 IPI00465439.4
392 S_Total95_875 IPI00006934.1 |SWISS-PROT:Q9UJM8 |REFSEQ_NP:NP_060015 |ENSEMBL:ENSP00000217301 Tax_Id=9606 Hydroxyacid oxidase 1 17 AIFVTVDTPYLGNR; GVQDVLEILK; LICINDYEQHAK; NVAETDLSTSVLGQR; AIDPSISWEDIK; NFETSTLSFSPEENFGDDSGLAAYVAK; QLDGVPATIDVLPEIVEAVEGK; PIVWGLAFQGEK; GVQDVLEILKEEFR; SGANDEETLADNIAAFSR; MAHVDGELATVR; VEVFLDGGVR; VSMPICVGATAMQR; HGLNGILVSNHGAR; LAMALSGCQNVK; LTSLPIVAK; PMF; Comb 1 IPI00006934.1
393 S_Total95_894 IPI00297779.6 |SWISS-PROT:P78371 |TREMBL:Q9H369 |REFSEQ_NP:NP_006422 |ENSEMBL:ENSP00000299300 Tax_Id=9606 T-complex protein 1, beta subunit 17 VQDDEVGDGTTSVTVLAAELLR; EALLSSAVDHGSDEVK; GATQQILDEAER; LGGSLADSYLDEGFLLDK; LTSFIGAIAIGDLVK; SLHDALCVLAQTVK; LALVTGGEIASTFDHPELVK; LKGSGNLEAIHIIK; QVLLSAAEAAEVILR; HGINCFINR; ILIANTGMDTDK; GSGNLEAIHIIK; AAHSEGNTTAGLDMR; DASLMVTNDGATILK; MLPTIIADNAGYDSADLVAQLR; QLIYNYPEQLFGAAGVMAIEHADFAGVER; PMF; Comb 1 IPI00297779.6
394 S_Total95_1086 IPI00552394.1 |TREMBL:Q5JYK5 |H-INV:HIT000025238; HIT000031080 Tax_Id=9606 OTTHUMP00000039155 17 PGVFDLINK; LHAVNAEECNVLQGR; LTAGEACAQGLVTEVFPDSTFQK; STGFETLVVTSEDGITK; WLSDECTNAVVNFLSR; KSTGFETLVVTSEDGITK; QNYVDLVSSLSPSLESSSQVEPGTDR; KLTAGEACAQGLVTEVFPDSTFQK; WDAWNALGSLPK; EFVGCFIDFPK; ATEMLIFGK; DFENSMNQVK; NAINTEMYHEIMR; QNYVDLVSSLSPSLESSSQVEPGTDRK; ATFHTPFSHLGQSPEGCSSYTFPK; DDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEK; Comb; PMF 1 IPI00552394.1
395 S_Total95_1087 IPI00216133.4 |SWISS-PROT:Q06520 |REFSEQ_NP:NP_003158 |ENSEMBL:ENSP00000222002 |H-INV:HIT000038939 Tax_Id=9606 Alcohol sulfotransferase 17 DEDVIILTYPK; LFSSHLPIQLFPK; NFLLLSYEELK; NHFTVAQAEDFDK; TLEPEELNLILK; WIQSVPIWER; SPWVESEIGYTALSETESPR; VRDEFVIR; DEFVIRDEDVIILTYPK; DVLVSGYFFWK; ICQFLGK; NHFTVAQAEDFDKLFQEK; SGTNWLAEILCLMHSK; MSNYSLLSVDYVVDK; VRDEFVIRDEDVIILTYPK; NFLLLSYEELKQDTGR; Comb; PMF 1 IPI00216133.4
396 S_Total95_1217 IPI00218097.1 |TREMBL:Q8IZX7 |ENSEMBL:ENSP00000350453 Tax_Id=9606 JNK-associated leucine-zipper protein 17 YNAPTSHVTPSVK; EVENLILENTQLLETK; FFVAVPGQVISPQSSSSGTDLTGDK; VDELTCEKDVLQGELEAVK; ETDYPAGEDLSESGQVDK; AGPSAQEPGSQTPLK; AFDFLSEETEASLASR; AKDDDDSDIPTAQR; ATTPASTANSDVATIPTDTPLK; LGFSFVRITALMVSCNR; SEVQAIIESTPELDMDK; DDNEQLITQYER; MGDEGGESELLGEDLPLEPSVTK; ATTPASTANSDVATIPTDTPLKEENEGFVK; ERPISLGIFPLPAGDGLLTPDAQK; HTEMIHNYMEHLER; Comb; PMF 2 IPI00479676.3, IPI00218097.1
397 S_Total95_1268 IPI00217966.5 |SWISS-PROT:P00338 |TREMBL:Q6IBM7; Q53G53 |REFSEQ_NP:NP_005557 |ENSEMBL:ENSP00000227157 |H-INV:HIT000009789 Tax_Id=9606 Lactate dehydrogenase A variant 17 DLADELALVDVIEDK; DQLIYNLLK; LVIITAGAR; LIIVSNPVDILTYVAWK; VIGSGCNLDSAR; DQLIYNLLKEEQTPQNK; LKGEMMDLQHGSLFLR; NVNIFKFIIPNVVK; GEMMDLQHGSLFLR; ITVVGVGAVGMACAISILMK; LGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLK; QVVESAYEVIK; SADTLWGIQK; VTLTSEEEAR; DDVFLSVPCILGQNGISDLVK; GYTSWAIGLSVADLAESIMK; PMF; Comb 1 IPI00217966.5
398 S_Total95_1361 IPI00158296.2 |TREMBL:O60310; Q5JUE1 |REFSEQ_NP:NP_055873 |ENSEMBL:ENSP00000251030 |H-INV:HIT000008706; HIT000000281 Tax_Id=9606 HypotHetical protein LOC23078 isoform a 17 DGLIVYEDSPLVK; DIYYLPFKDQLK; LSQYPNENLHSAVTK; SIAMQYLELTKR; DTTVQTLTLQPSVK; AGTAFYIDQCAVR; EKVPNVPQEALDK; VPNVPQEALDK; ETQDPTAQSLAASLSTR; HAIQWLYPYSILLGHEGK; PHSELEMLRQYGPNVPEPILQK; NVFDFDSYNNDMREILINTLHKYGIPIGAK; DVTPPQTSGYIEVTDLQSK; GPALINIQEYPIER; RGELEPQLGSPQQKPK; GNSLTVLDVLEGRTHTISLPINLK; PMF 1 IPI00158296.2
399 S_Total95_1420 IPI00009634.1 |SWISS-PROT:Q9Y6N5 |TREMBL:Q9UHS8; Q53HW7 |REFSEQ_NP:NP_067022 |ENSEMBL:ENSP00000260324 |H-INV:HIT000037708 Tax_Id=9606 Sulfide:quinone oxidoreductase, mitochondrial precursor 17 KVGAENVAIVEPSER; TAAAVAAQSGILDR; VILAEFDYK; AEPLETFPFDQSK; ANIIFNTSLGAIFGVK; GLPEGFAHPK; GYWGGPAFLR; VGAENVAIVEPSER; ANIIFNTSLGAIFGVKK; EGNAIFTFPNTPVK; YADALQEIIQER; IMYLSEAYFR; HFYQPIWTLVGAGAK; ISYRYLIIALGIQLDYEK; PTASVIPSGVEWIK; VTELNPDKNCIHTDDDEK; Comb 1 IPI00009634.1
400 S_Total95_1693 IPI00470790.1 |TREMBL:Q68CJ7 Tax_Id=9606 Hypothetical protein HMFN0320 17 DLVQESLR; TPSLSPVEK; AYPIEQYPCQTK; YLGIEDLAGK; RYLGIEDLAGK; AAVIVGCIGVIAEVDK; FFFWDYGNAFLLEAQR; VFVTSGLGGMSGAQAK; LVITNGMVIPNYSSR; QGWLMEVTDSLDR; WVCTSGDPQDLAVTDELATSVLEEAIADGVK; LQYMDNIR; LMLSWDVSNGVAR; VAIAVAINQAIACR; YPSYVQHIMGDIFSQGFGPFR; DHHDVSGTDSPFR; Comb 2 IPI00043499.3, IPI00470790.1
401 S_Total95_1843 IPI00514925.1 |ENSEMBL:ENSP00000354516 Tax_Id=9606 137 kDa protein 17 AFLQGGQEATDIALLLR; ASEQIYGTPSSSPYECLR; QSQIQVFEDGADTTSPETPDSSASK; TSPAAKSPSAQLMEQVAQLK; AEITDAEGLGLK; AESLQQEVEALK; ASLASLPPLHVAK; FELSENCSERPGLR; DQLDETVNVEPLTK; LQEELSQAESTIDELK; ELTNQQEASVER; EFEETMDALQADIDQLEAEK; EQVDAALGAEEMVEMLTDR; VDELTTDLEILK; ETVSQRPGATVPTDFATFPSSAFLR; GPPPSGIATLVSGIAGGAIPGQAPGSVPGPGLVK; PMF 1 IPI00514925.1
402 S_Total95_1997 IPI00219299.1 |SWISS-PROT:Q9Y4G6 |REFSEQ_NP:NP_055874 |ENSEMBL:ENSP00000303476 |H-INV:HIT000000026 Tax_Id=9606 Talin 2 17 FFYSDQNVDSR; QVAASTAQLLVACK; RLQAAGNAVK; EVANSTANLVK; DPVQLNLLYVQAR; VMVTNVTSLLK; TVGELLVTICSR; GAAKVMVTNVTSLLKTVK; LAQAAQSSAATITQLAEVVK; LLGITKDSVMR; NPAAQQQLVQSCK; DVDVALKSIGESSK; FVGGIAQIIAAQEEMLK; NCGEMSEIEAK; NLATSLAELR; GTEWVDPEDPTVIAETELLGAAASIEAAAK; PMF 1 IPI00219299.1
403 S_Total95_2488 IPI00301491.1 |SWISS-PROT:P06133 |TREMBL:Q6QQX7 |REFSEQ_NP:NP_066962 |ENSEMBL:ENSP00000305221 |H-INV:HIT000040168 Tax_Id=9606 UDP-glucuronosyltransferase 2B4 precursor 17 ANVIASALAKIPQK; WDQFYSEVLGR; WIPQNDLLGHPK; FDGNKPDTLGLNTR; AVFWIEFVMR; KWDQFYSEVLGR; IHHDQPVKPLDR; TVINDPLYK; FEVYPVSLTK; TILDELVQR; ANVIASALAK; FDVVLADAVFPFGELLAELLK; ADIWLIR; TEFEDIIK; VLVWPTEFSHWMNIK; NYWDFQFPHPLLPNVEFVGGLHCK; HSGGLLFPPSYVPVVMSELSDQMTFIER 1 IPI00301491.1
404 S_Total95_2633 IPI00025831.1 |SWISS-PROT:P20815 |TREMBL:Q7Z447; Q96RK6; Q53GC3; Q86SK1; Q7Z446; Q75MV0 |REFSEQ_NP:NP_000768 |ENSEMBL:ENSP00000222982 |H-INV:HIT000012493; HIT000041999 Tax_Id=9606 Cytochrome P450 3A5 17 ECYSVFTNR; ETQIPLK; SLLSPTFTSGK; VLQNFSFKPCK; SAISIAEDEEWKR; SAISIAEDEEWK; LGIPGPTPLPLLGNVLSYR; LDTQGLLQPEKPIVLK; DSIDPYIYTPFGTGPR; KKDSIDPYIYTPFGTGPR; LKEMFPIIAQYGDVLVR; YWTEPEEFRPER; DVEINGVFIPK; DTINFLSK; EMFPIIAQYGDVLVR; LDFLQLMIDSQNSK; APPTYDAVVQMEYLDMVVNETLR 1 IPI00025831.1
405 S_Total95_3319 IPI00413492.1 |SWISS-PROT:P20810-4 |REFSEQ_NP:NP_775083 |ENSEMBL:ENSP00000312523; ENSP00000355359 |H-INV:HIT000027086; HIT000027261 Tax_Id=9606 Calpastatin isoform b 17 GTVPDDAVEALADSLGK; SESELIDELSEDFDR; AAAPAPVSEAVCR; DTSQSDKDLDDALDK; SESELIDELSEDFDRSECK; CGEDDETIPSEYR; DTMSDQALEALSASLGTR; LAAAISEVVSQTPASTTQAGAPPR; TKPQDMISAGGESVAGITAISGK; HLLDDNGQDKPVKPPTK; TSMCSIQSAPPEPATLK; KPADDQDPIDALSGDLDSCPSTTETSQNTAK; SLTPAVPVESKPDKPSGK; PIGPDDAIDALSSDFTCGSPTAAGK; EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK; KEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK; TEPEKKSQSTK 2 IPI00413492.1, IPI00396082.3
406 S_Total95_3478 IPI00013079.1 |SWISS-PROT:Q9Y6C2 |TREMBL:Q96IH6; Q53SY9 |REFSEQ_NP:NP_008977 |ENSEMBL:ENSP00000260650 |H-INV:HIT000024016 Tax_Id=9606 EMILIN 1 precursor 17 LVGSGLHTVEAAGEAR; VQQLEEQVQSLTK; GLEEGQAQAGQCPSLEGR; LQESCSVCLAGLDGFR; YLLSAVLTGHR; APAPASAPPGPSEELLR; VDAQDETAAEFTLR; LDTVAGGLQGLR; QATLEGLQEVVGR; VLLNDGGYYDPETGVFTAPLAGR; VEAVLSRSNQGVAR; HVAGLWAGLR; LQQEATEHATESEER; PGVHETLNEIQHQLQLLDTR; GTELGGAAGQGGHPPGYTSLASRLSRLEDR; PARPNLSGSSAGSPLSGLGGEGPGESEK; LGQLEGLLQAHGDEGCGACGGVQEELGR 1 IPI00013079.1
407 S_Total95_3666 IPI00022143.3 |TREMBL:O94848; Q9H6W2; Q9BSJ8; Q9H6J1; Q9Y416; Q6PJN4 |REFSEQ_NP:NP_056107 |ENSEMBL:ENSP00000267113 |H-INV:HIT000024012; HIT000015148; HIT000032144; HIT000008737; HIT000000472; HIT000006064; HIT000009152 Tax_Id=9606 Family with sequence similarity 62 (C2 domain containing), member A 17 ALTLGALTLPLAR; FFLQDPQSQELDVQVK; LTTVLNSGFLDEWLTLEDVPSGR; AVYSTNCPVWEEAFR; ELPAWVSFPDVEK; FEWELPLDEAQR; LEWLSLLSDAEK; LLAETVAPAVR; LLVPLVPDLQDVAQLR; LVSIVHGCR; VQLDLAETDLSQGVAR; DLDKDDFLGR; DPPDPYVSLLLLPDK; IVAQVWPFLGQYMEK; KEQILLDLNISYVGDVQIDVEVKK; TKTISQTSAPVWDESASFLIRK; KPHTESLELQVR 1 IPI00022143.3
408 S_Total95_3668 IPI00293464.4 |SWISS-PROT:Q16531 |TREMBL:Q58F96; Q13289 |REFSEQ_NP:NP_001914 |ENSEMBL:ENSP00000301764 |H-INV:HIT000035375 Tax_Id=9606 DNA damage binding protein 1 17 ALYYLQIHPQELR; LEELHVIDVK; ETDDTLVLSFVGQTR; IAVMELFRPK; ICYQEVSQCFGVLSSR; LEIYVVTAEGLRPVK; LVFSNVNLK; QGQGQLVTCSGAFK; YLAIAPPIIK; IVVFQYSDGK; QSGESIDIITR; DPNTYFIVGTAMVYPEEAEPK; IAVMELFR; TEPATGFIDGDLIESFLDISR; KTEPATGFIDGDLIESFLDISR; IEVQDTSGGTTALRPSASTQALSSSVSSSK; KTEPATGFIDGDLIESFLDISRPK 1 IPI00293464.4
409 S_Total95_3811 IPI00001639.2 |SWISS-PROT:Q14974 |TREMBL:Q53XN2 |REFSEQ_NP:NP_002256 |ENSEMBL:ENSP00000290158 |H-INV:HIT000031610 Tax_Id=9606 Importin beta-1 subunit 17 GALQYLVPILTQTLTK; LAATNALLNSLEFTK; LLETTDRPDGHQNNLR; TVSPDRLELEAAQK; YLEVVLNTLQQASQAQVDK; ESCLEAYTGIVQGLK; ESTLEAIGYICQDIDPEQLQDK; YMEAFKPFLGIGLK; QDENDDDDDWNPCK; AAVENLPTFLVELSR; VLANPGNSQVAR; SDYDMVDYLNELR; SSAYESLMEIVK; PLVIQAMPTLIELMK; IQFNDLQSLLCATLQNVLR; MFQSTAGSGGVQEDALMAVSTLVEVLGGEFLK; GDQENVHPDVMLVQPR 1 IPI00001639.2
410 S_Total95_4170 IPI00394892.1 |SWISS-PROT:Q8NF91-8 |TREMBL:Q7RTM4; Q5BKU8; Q7Z3K4; Q5JV22 |REFSEQ_NP:NP_056108 |ENSEMBL:ENSP00000349276 |H-INV:HIT000000521; HIT000014566 Tax_Id=9606 Spectrin-like protein of the nuclear envelope and Golgi 17 YLGLYTILPSELSLQLAEVALDLK; NESDLIEKDLNDALQNAK; GSQSVQKFVTLSNVLK; AKTDNVVQAK; KIQQSVSEFEDKLAVPIK; EMKVWIEQFERDLTR; LLDPEDVDVDKPDEK; LNMAIGKGEQALR; SAVSKVLENASSVIVTRTTIK; TDNVVQAKTDQK; VSGLIKEYNCLCLQASKGCQNK; EDLEQKVASLELR; CEKGIADSLEKLR; LNEWAVFSEKNK; LWQKFLDDYSR; VASLQDMSCQLLVNAEGTDCLEAKEK; QDTLQQCQAWLSAVQPDLDPSPQPPLSR 1 IPI00394892.1
411 S_Total95_4333 IPI00044608.2 |TREMBL:Q96Q06 |REFSEQ_XP:XP_375558 |ENSEMBL:ENSP00000301286 |H-INV:HIT000001596 Tax_Id=9606 PREDICTED: KIAA1881 17 AVLTGTKDTVSTGLTGAVNVAK; DTVCSGVTGAVNVAK; DAVCSGVTGAANVAK; DTVCSGVTGAANVAK; DTVCSGVTGAMNVAK; DTVCSGVTSAVNVAK; LDQGSGASAEDAAVQEER; DAVTTGVTGAVNVAK; NTVCSGVTGAVNLAK; DAVSTGLTGAVNVAK; DTVSTGLTGAVNVAK; DTIYSGVTSAVNVAK; SVLTGTKDAVSTGLTGAVK; GAMQTGLNTTQNIATGTK; DAVSSGVASVVDVAK; DLVCSKMSRAK; AVLMGTKDTVFSGVTGAMSMAKGAVQGGLDTTK 1 IPI00044608.2
412 S_Total95_5329 IPI00012837.1 |SWISS-PROT:P33176 |TREMBL:Q66K46; Q6P164; Q5VZ85 |REFSEQ_NP:NP_004512 |ENSEMBL:ENSP00000349444 Tax_Id=9606 Kinesin heavy chain 17 LYLVDLAGSEK; VSKTGAEGAVLDEAK; EYELLSDELNQK; LITDLQDQNQK; VFQSSTSQEQVYNDCAK; SAEIDSDDTGGSAAQK; TGAEGAVLDEAK; TTIVICCSPSSYNESETK; GGGAFVQNSQPVAVR; DEEINQQSQLVEK; ISFLENNLEQLTK; LFVQDLATR; SLTEYLQNVEQK; NTIQWLENELNR; PGQHPAASPTHPSAIR; PIRPGQHPAASPTHPSAIR; KLHELTVMQDR 2 IPI00472558.1, IPI00012837.1
413 S_Total95_88 IPI00216136.1 |SWISS-PROT:P50053-2 |REFSEQ_NP:NP_006479 |ENSEMBL:ENSP00000260598 Tax_Id=9606 Splice Isoform C of Ketohexokinase 16 GVDVSQVAWQSK; HLGFQSAEEALR; LLHSDAFPPPR; CGLQGFDGIV; TIVLHDTSLPDVSATDFEK; RGVDVSQVAWQSK; EELFQLFGYGDVVFVSK; GDTPSSCCIINNSNGNR; VVDTLGAGDTFNASVIFSLSQGR; GAVLVCAWAEEGADALGPDGK; KGAVLVCAWAEEGADALGPDGK; FGCQVAGK; VSVEVEKPR; FGCQVAGKKCGLQGFDGIV; VSVEVEKPREELFQLFGYGDVVFVSK; PMF; Comb 1 IPI00216136.1
414 S_Total95_103 IPI00025341.2 |SWISS-PROT:Q02338 |REFSEQ_NP:NP_004042; NP_976060; NP_976059 |ENSEMBL:ENSP00000292881; ENSP00000350914; ENSP00000352287 |H-INV:HIT000038635; HIT000035569; HIT000032475 Tax_Id=9606 D-beta-hydroxybutyrate dehydrogenase, mitochondrial precursor 16 FGVEAFSDCLR; MWEELPEVVR; TVQLNVCSSEEVEK; VSVVEPGNFIAATSLYSPESIQAIAK; VVNISSMLGR; AVLVTGCDSGFGFSLAK; GRVVNISSMLGR; QVAEVNLWGTVR; TVQLNVCSSEEVEKVVEIVR; GFLVFAGCLMK; YHPMDYYWWLR; KMWEELPEVVR; MQIMTHLPGAISDMIYIR; YEMYPLGVK; METYCSSGSTDTSPVIDAVTHALTATTPYTR; Comb; PMF 1 IPI00025341.2
415 S_Total95_107 IPI00021841.1 |SWISS-PROT:P02647 |TREMBL:Q9UCT8; Q6LEJ8; Q8TDB0; Q6Q785; Q9Y355 |REFSEQ_NP:NP_000030 |REFSEQ_XP:XP_496536 |ENSEMBL:ENSP00000352471; ENSP00000236850 |H-INV:HIT000032425 Tax_Id=9606 Apolipoprotein A-I precursor 16 DYVSQFEGSALGK; VSFLSALEEYTK; DLATVYVDVLK; THLAPYSDELR; VKDLATVYVDVLK; VQPYLDDFQK; EQLGPVTQEFWDNLEK; LLDNWDSVTSTFSK; QGLLPVLESFK; LREQLGPVTQEFWDNLEK; LAARLEALKENGGAR; ATEHLSTLSEK; WQEEMELYRQK; WQEEMELYR; AKPALEDLR; PMF; Comb 1 IPI00021841.1
416 S_Total95_119-1 IPI00301109.3 |SWISS-PROT:Q9H2U2-1 |REFSEQ_NP:NP_789845 |ENSEMBL:ENSP00000343885 Tax_Id=9606 Splice Isoform 1 of Inorganic pyrophosphatase 2, mitochondrial precursor 16 ILSCGEVIHVK; LIAINANDPEASK; SLVESVSSSPNK; YVANIFPYK; ESNEEEQVWHFLGK; FKPGYLEATLNWFR; STNCFGDNDPIDVCEIGSK; LGTSAGTGSRR; RAMALYHTEER; ILGILALIDEGETDWK; AFALEVIK; GYIWNYGTLPQTWEDPHEK; NVTGHYISPFHDIPLK; SLVESVSSSPNKESNEEEQVWHFLGK; VPDGKPENQFAFNGEFK; Comb; PMF 1 IPI00301109.3
417 S_Total95_119-2 IPI00470502.1 |SWISS-PROT:Q9H2U2-2 |ENSEMBL:ENSP00000349996 Tax_Id=9606 Splice Isoform 2 of Inorganic pyrophosphatase 2, mitochondrial precursor 16 ILSCGEVIHVK; LIAINANDPEASK; SLVESVSSSPNK; YVANIFPYK; ESNEEEQVWHFLGK; FKPGYLEATLNWFR; STNCFGDNDPIDVCEIGSK; LGTSAGTGSRR; RAMALYHTEER; ILGILALIDEGETDWK; AFALEVIK; GYIWNYGTLPQTWEDPHEK; NVTGHYISPFHDIPLK; SLVESVSSSPNKESNEEEQVWHFLGK; VPDGKPENQFAFNGEFK; Comb; PMF 1 IPI00470502.1
418 S_Total95_149 IPI00004358.3 |SWISS-PROT:P11216 |TREMBL:Q59GM9; Q8TDG6 |REFSEQ_NP:NP_002853 |ENSEMBL:ENSP00000216962 |H-INV:HIT000037804; HIT000041139 Tax_Id=9606 Glycogen phosphorylase, brain form 16 VLYPNDNFFEGK; LKQEYFVVAATLQDIIR; VIFLENYR; QEYFVVAATLQDIIR; LAACFLDSMATLGLAAYGYGIR; VEDVEALDR; QAVDQISSGFFSPK; IGEEFLTDLSQLK; LLPLVSDEVFIR; WLLLCNPGLADTIVEK; LQDFNVGDYIEAVLDR; GLAGLGDVAEVR; HLDHVAALFPGDVDR; INMAHLCVIGSHAVNGVAR; ARPEYMLPVHFYGR; Comb 1 IPI00004358.3
419 S_Total95_164 IPI00031708.1 |SWISS-PROT:P16930 |TREMBL:Q53XA7 |REFSEQ_NP:NP_000128 |ENSEMBL:ENSP00000261755 |H-INV:HIT000030966 Tax_Id=9606 Fumarylacetoacetase 16 ASSVVVSGTPIR; HLFTGPVLSK; LGEPIPISK; VFLQNLLSVSQAR; IGVAIGDQILDLSIIK; WEYVPLGPFLGK; FLLDGDEVIITGYCQGDGYR; KFLLDGDEVIITGYCQGDGYR; GEGMSQAATICK; LLDMELEMAFFVGPGNR; IGFGQCAGK; GTKPIDLGNGQTR; CAFISQASATMHLPATIGDYTDFYSSR; DKENALMPNWLHLPVGYHGR; QHATNVGIMFR; PMF; Comb 1 IPI00031708.1
420 S_Total95_174 IPI00291006.1 |SWISS-PROT:P40926 |TREMBL:Q75MP7; Q75MT9; Q6FHZ0 |REFSEQ_NP:NP_005909 |ENSEMBL:ENSP00000327070 |H-INV:HIT000030745 Tax_Id=9606 Malate dehydrogenase, mitochondrial precursor 16 EGVVECSFVK; GCDVVVIPAGVPR; GYLGPEQLPDCLK; IFGVTTLDIVR; TIIPLISQCTPK; VDFPQDQLTALTGR; VNVPVIGGHAGK; MISDAIPELK; AGAGSATLSMAYAGAR; SQETECTYFSTPLLLGK; VAVLGASGGIGQPLSLLLK; FVFSLVDAMNGK; IQEAGTEVVK; LTLYDIAHTPGVAADLSHIETK; ANTFVAELK; PMF; Comb 1 IPI00291006.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home