Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
421 S_Total95_289 IPI00024580.3 |SWISS-PROT:Q96RQ3 |TREMBL:Q68D27 |REFSEQ_NP:NP_064551 |ENSEMBL:ENSP00000265594 |H-INV:HIT000031788; HIT000031766; HIT000006325; HIT000023241 Tax_Id=9606 Methylcrotonoyl-CoA carboxylase alpha chain, mitochondrial precursor 16 WHRLPSLLLPPRTWVWR; EGSIEIDIPVPK; ESLCQAALGLILK; QEGIIFIGPPPSAIR; TFQVLGNLYSEGDCTYLK; IPLSQEEITLQGHAFEAR; LGVQTVAVYSEADR; IIEEAPAPGIK; ESLCQAALGLILKEK; SFNDDAMLIEK; YLSSVSSQETQGGPLAPMTGTIEK; TSAAQAIHPGCGFLSENMEFAELCK; HTPLVEFEEEESDKR; IYAEDPSNNFMPVAGPLVHLSTPR; SEQEFQEQLESAR; Comb; PMF 1 IPI00024580.3
422 S_Total95_359 IPI00396378.3 |SWISS-PROT:P22626-1 |REFSEQ_NP:NP_112533 |ENSEMBL:ENSP00000265397 Tax_Id=9606 Splice Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 16 DYFEEYGK; IDTIEIITDR; NYYEQWGK; GFGFVTFDDHDPVDK; GGGGNFGPGPGSNFR; LFIGGLSFETTEESLR; GFGDGYNGYGGGPGGGNFGGSPGYGGGR; IFVGGIKEDTEEHHLR; KLFIGGLSFETTEESLR; GGNFGFGDSR; NMGGPYGGGNYGPGGSGGSGGYGGR; LTDCVVMR; KIFVGGIKEDTEEHHLR; YHTINGHNAEVR; LFVGGIKEDTEEHHLR; PMF; Comb 1 IPI00396378.3
423 S_Total95_411 IPI00003944.1 |SWISS-PROT:P11182 |TREMBL:Q5VVL8; Q5VVL7 |REFSEQ_NP:NP_001909 |ENSEMBL:ENSP00000260559 |H-INV:HIT000037627 Tax_Id=9606 Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor 16 ILKEDILNYLEK; SYLENPAFMLLDLK; LSFMPFFLK; LYYNLDDIAYVGK; NVQICSIFDIATELNR; AASLGLLQFPILNASVDENCQNITYK; LREELKPIAFAR; LSDIGEGIR; LSEVVGSGK; DMTVPILVSKPPVFTGK; PLVDIETEALK; PVIMPPEVAIGALGSIK; LYYNLDDIAYVGKPLVDIETEALK; DSEEDVVETPAVSHDEHTHQEIK; IPHFGYCDEIDLTELVK; Comb; PMF 1 IPI00003944.1
424 S_Total95_413 IPI00019383.1 |SWISS-PROT:P51570 |TREMBL:Q71UH7 |REFSEQ_NP:NP_000145 |ENSEMBL:ENSP00000225614 |H-INV:HIT000030189 Tax_Id=9606 Galactokinase 16 EVQLEELEAAR; LAVLITNSNVR; SLETSLVPLSDPK; DDYEVSCPELDQLVEAALAVPGVYGSR; EEFGAEPELAVSAPGR; HSLASSEYPVR; QPQVAELLAEAR; AFREEFGAEPELAVSAPGR; LQFPLPTAQR; GHALLIDCR; VNLIGEHTDYNQGLVLPMALELMTVLVGSPR; MTGGGFGGCTVTLLEASAAPHAMR; HIQEHYGGTATFYLSQAADGAK; KDGLVSLLTTSEGADEPQR; DGLVSLLTTSEGADEPQR; PMF; Comb 1 IPI00019383.1
425 S_Total95_445 IPI00218831.3 |SWISS-PROT:P09488 |TREMBL:Q16041 |REFSEQ_NP:NP_000552 |ENSEMBL:ENSP00000311469 Tax_Id=9606 Glutathione S-transferase Mu 1 16 YLEELPEK; YLEELPEKLK; LLLEYTDSSYEEK; YTMGDAPDYDR; LLLEYTDSSYEEKK; KYTMGDAPDYDR; ITQSNAILCYIAR; LGLDFPNLPYLIDGAHK; LYSEFLGK; ITFVDFLVYDVLDLHR; CLDAFPNLK; FLPRPVFSK; RPWFAGNK; PMILGYWDIR; VDILENQTMDNHMQLGMICYNPEFEK; Comb; PMF 1 IPI00218831.3
426 S_Total95_483 IPI00306959.7 |SWISS-PROT:P08729 |TREMBL:Q96GE1 |REFSEQ_NP:NP_005547 |ENSEMBL:ENSP00000329243 |H-INV:HIT000031109; HIT000009155 Tax_Id=9606 Keratin, type II cytoskeletal 7 16 LALDIEIATYR; TLNNKFASFIDKVR; FASFIDK; TLNNKFASFIDK; KLLEGEESR; FASFIDKVR; LALDLEIATYR; SLDLDGIIAEVK; QEELEAALQR; SAYGGPVGAGIR; VDALNDEINFLR; GQLEALQVDGGR; LEAAIAEAEER; LPDIFEAQIAGLR; FLEQQNKLLETKWTLLQEQK; PMF; Comb 1 IPI00306959.7
427 S_Total95_607 IPI00221225.2 |SWISS-PROT:P09525 |TREMBL:Q6LES2; Q6MZI0; Q59FK3 |REFSEQ_NP:NP_001144 |ENSEMBL:ENSP00000347164 |H-INV:HIT000014623; HIT000029413; HIT000035356 Tax_Id=9606 Annexin A4 16 ISQTYQQQYGR; VLLVLCGGDD; DEGNYLDDALVR; GLGTDDNTLIR; SETSGSFEDALLAIVK; GLGTDEDAIISVLAYR; NHLLHVFDEYKR; QDAQDLYEAGEK; VLVSLSAGGR; FLTVLCSR; AASGFNAMEDAQTLR; AEIDMLDIR; NHLLHVFDEYK; VLVSLSAGGRDEGNYLDDALVR; GAGTDEGCLIEILASR; PMF; Comb 1 IPI00221225.2
428 S_Total95_673 IPI00290566.1 |SWISS-PROT:P17987 |TREMBL:Q5TCM3 |REFSEQ_NP:NP_110379 |ENSEMBL:ENSP00000239585 |H-INV:HIT000029818 Tax_Id=9606 T-complex protein 1, alpha subunit 16 EVGDGTTSVVIIAAELLK; FATEAAITILR; HGSYEDAVHSGALND; SLLVIPNTLAVNAAQDSTDLVAK; EQLAIAEFAR; ICDDELILIK; SLHDALCVVK; YINENLIVNTDELGR; IACLDFSLQK; LLEVEHPAAK; VLCELADLQDK; GANDFMCDEMER; MLVDDIGDVTITNDGATILK; ASGATILSTLANLEGEETFEAAMLGQAEEVVQER; ICDDELILIKNTKAR; Comb; PMF 1 IPI00290566.1
429 S_Total95_677 IPI00604662.1 |REFSEQ_NP:NP_055415 |ENSEMBL:ENSP00000327116 |H-INV:HIT000041801 Tax_Id=9606 EH-domain containing 3 16 LDISDEFSEVIK; EHQISPGDFPNLK; LNAFGNAFLNR; KLNAFGNAFLNR; VYIGSFWSHPLLIPDNRK; LNDLIKR; LFEAEEQDLFR; GYDFAAVLEWFAER; VYIGSFWSHPLLIPDNR; YLLEQDFPGMR; ELVNNLAEIYGR; KEMPSVFGKDNK; FVCAQLPNPVLESISVIDTPGILSGEK; MQDQLQAQDFSK; LADIDKDGMLDDDEFALANHLIK; LEGHELPNELPAHLLPPSK 1 IPI00604662.1
430 S_Total95_716 IPI00013896.2 |SWISS-PROT:P63244 |TREMBL:Q53HU2; Q5VLR4; Q6FH47 |REFSEQ_NP:NP_006089 |H-INV:HIT000036604; HIT000041407; HIT000038545; HIT000034815; HIT000037922; HIT000039335; HIT000038660; HIT000029437; HIT000036857; HIT000029557 Tax_Id=9606 Lung cancer oncogene 7 16 DETNYGIPQR; YWLCAATGPSIK; LWDLTTGTTTR; VWNLANCK; DVLSVAFSSDNR; FSPNSSNPIIVSCGWDK; IIVDELKQEVISTSSK; LWNTLGVCK; VWQVTIGTR; YTVQDESHSEWVSCVR; TNHIGHTGYLNTVTVSPDGSLCASGGK; HLYTLDGGDIINALCFSPNR; DGQAMLWDLNEGK; GHNGWVTQIATTPQFPDMILSASR; GHSHFVSDVVISSDGQFALSGSWDGTLR; PMF; Comb 1 IPI00013896.2
431 S_Total95_738 IPI00017367.1 |SWISS-PROT:P35241 |TREMBL:Q9NST9; Q6PKD3 |REFSEQ_NP:NP_002897 |ENSEMBL:ENSP00000342830 |H-INV:HIT000026039 Tax_Id=9606 Radixin 16 APDFVFYAPR; IGFPWSEIR; AQKELEEQTR; KPDTIEVQQMK; LFFLQVK; RKPDTIEVQQMK; QLQALSSELAQAR; FFPEDVSEELIQEITQR; IALLEEAK; NQEQLAAELAEFTAK; AFAAQEDLEK; EVWFFGLQYVDSK; TQNDVLHAENVK; EAILNDEIYCPPETAVLLASYAVQAK; KTQNDVLHAENVK; Comb; PMF 1 IPI00017367.1
432 S_Total95_751 IPI00028910.1 |SWISS-PROT:Q14117 |REFSEQ_NP:NP_001376 |ENSEMBL:ENSP00000276651 |H-INV:HIT000042121 Tax_Id=9606 Dihydropyrimidinase 16 KPFAEYIYK; VVYEAGVFSVTAGDGK; VVNDDFSEVADVLVEDGVVR; ALGHDLLPPGGAPAGLR; FVAVTSTNAAK; GGSLIEAFETWR; VVYGEPIAASLGTDGTHYWNK; EIGAIAQVHAENGDLIAEGAK; IAVGSDADIVIWDPK; IPNGVNGVEDR; ALGKDDFTK; IFNLYPR; AALSGGTTMIIDFAIPQK; THHQAVNFNIFEGMVCHGVPLVTISR; MLALGITGPEGHELCRPEAVEAEATLR; Comb 1 IPI00028910.1
433 S_Total95_1012 IPI00333838.1 |SWISS-PROT:Q86TX2 |ENSEMBL:ENSP00000311224 Tax_Id=9606 Cytosolic acyl coenzyme A thioester hydrolase, inducible 16 ADTLGELDLER; GLAPEQPVTLR; DGYADIVDVLNSPLEGPDQK; TPLAVELEVLDGHDPDPGR; YKGETLPPVGVNR; CCWDEPVR; AESTFLFLVGQDDHNWK; ASLHALVGSPIIWGGEPR; GPGVGLLGISK; SEFYANEACK; GTLFLPPEPGPFPGIVDMFGTGGGLLEYR; KPQIICYPETGHYIEPPYFPLCR; HLGGHEGTIPSK; TMETLHLEYFEEAVNYLLSHPEVK; YFLPPGVR; Comb; PMF 1 IPI00333838.1
434 S_Total95_1082 IPI00021842.1 |SWISS-PROT:P02649 |TREMBL:Q6LBZ1; Q6LA97; Q8TCZ8; Q13791 |REFSEQ_NP:NP_000032 |ENSEMBL:ENSP00000252486 |H-INV:HIT000031595 Tax_Id=9606 Apolipoprotein E precursor 16 AATVGSLAGQPLQER; LAVYQAGAR; LQAEAFQAR; SELEEQLTPVAEETR; VQAAVGTSAAPVPSDNH; WVQTLSEQVQEELLSSQVTQELR; SWFEPLVEDMQR; ELQAAQARLGADMEDVCGR; LGADMEDVCGR; LGPLVEQGR; VEQAVETEPEPELR; AKLEEQAQQIR; EGAERGLSAIR; GEVQAMLGQSTEELR; LKSWFEPLVEDMQR; Comb; PMF 1 IPI00021842.1
435 S_Total95_1293 IPI00030275.5 |SWISS-PROT:Q12931 |TREMBL:Q5CAQ4; Q53FS6; Q59EK6; Q9BV61; Q53G55 |REFSEQ_NP:NP_057376 |ENSEMBL:ENSP00000246957 |H-INV:HIT000038485; HIT000014233; HIT000031342 Tax_Id=9606 Heat shock protein 75 kDa, mitochondrial precursor 16 GVVDSEDIPLNLSR; GVVDSEDLPLNISR; EGIVTATEQEVK; AFLDALQNQAEASSK; ELGSSVALYSR; YESSALPSGQLTSLSEYASR; EGIVTATEQEVKEDIAK; NIYYLCAPNR; ELISNASDALEK; ELLQESALIR; YSNFVSFPLYLNGR; GTITIQDTGIGMTQEELVSNLGTIAR; AQLLQPTLEINPR; LDTHPAMVTVLEMGAAR; SAAPGSLGYQWLSDGSGVFEIAEASGVR; Comb; PMF 1 IPI00030275.5
436 S_Total95_1312 IPI00061793.2 |TREMBL:Q96EX0 |ENSEMBL:ENSP00000321983 |H-INV:HIT000035512 Tax_Id=9606 Similar to Arg/Abl-interacting protein ArgBP2b 16 CDDGWFVGTSR; AQPARPPPPAQPGEIGEAIAK; VGIFPISYVEK; YNFNADTNVELSLR; KGDTVYILR; QGIFPVSYVEVVK; SYNDGNQETLNGDATYSSLAAK; SFTSSSPSSPSR; APHYPGIGPVDESGIPTAIR; FFGTFPGNYVK; ESDVIDVMEK; PMSSASMASDFR; QGIFPVSYVEVVKKNTK; VDLPGSSTTLTK; SSILQHERPPPLPTTPTPVPR; Comb; PMF 1 IPI00061793.2
437 S_Total95_1528 IPI00302925.3 |SWISS-PROT:P50990 |TREMBL:Q7Z759; Q53HU0 |REFSEQ_NP:NP_006576 |ENSEMBL:ENSP00000286788 |H-INV:HIT000042140 Tax_Id=9606 T-complex protein 1, theta subunit 16 DIDEVSSLLR; NVGLDIEAEVPAVK; AIADTGANVVVTGGK; FAEAFEAIPR; HFSGLEEAVYR; LATNAAVTVLR; LFVTNDAATILR; QITSYGETCPGLEQYAIK; AVDDGVNTFK; GEENLMDAQVK; IAVYSCPFDGMITETK; EDGAISTIVLR; ILGSGISSSSVLHGMVFK; QITSYGETCPGLEQYAIKK; LIAQACVSIFPDSGHFNVDNIR; Comb 1 IPI00302925.3
438 S_Total95_1629 IPI00604517.1 |TREMBL:Q8NB06 |H-INV:HIT000016609 Tax_Id=9606 Hypothetical protein FLJ34423 16 SISLYYTGEK; NDLAVVDVR; EVFEDAAEIR; EAMEDGEIDGNK; GLSEDTTEETLK; KFGYVDFESAEDLEK; TLVLSNLSYSATEETLQEVFEK; VEGTEPTTAFNLFVGNLNFNK; TGISDVFAK; FGYVDFESAEDLEK; GFGFVDFNSEEDAK; ALELTGLK; GYAFIEFASFEDAK; GIAYIEFK; KVAVATPAKAVTTPGK; PMF; Comb 1 IPI00604517.1
439 S_Total95_2203 IPI00016287.3 |SWISS-PROT:Q8IYQ7 |TREMBL:Q8N9J5; Q9H6P9 |REFSEQ_NP:NP_079114 |ENSEMBL:ENSP00000328525 |H-INV:HIT000037635; HIT000008929; HIT000019217 Tax_Id=9606 Threonine synthase-like 1 16 FFSEAVIEGLASDGGLFVPAK; FICASNQNHVLTDFIK; IAVVAFFPENGVSDFQK; KLAQTFSPSIDILK; LAQTFSPSIDILK; SHVEQLVQNQFI; TCPVIISSTAHYSK; YQDVDSETFISTR; LQDVGNEQFLEEEGK; VFCESGASPEEVADK; LGCCVIDVDDDILEK; SLVGATYVER; FAPAIMQALK; TDRIVGQNSGTSMKDLLK; HLSGNQFILELFHGPTGSFK; PMF 1 IPI00016287.3
440 S_Total95_2360 IPI00514011.1 |ENSEMBL:ENSP00000355193 Tax_Id=9606 30 kDa protein 16 FWANFAR; TPEELQAER; DAGAPTYMYEFQYR; PSFSSDMKPK; EGASEEEIR; EGYLQIGANTQAAQK; AVEKPPQTEHIEL; DKEVAFWTNLFAK; EVAFWTNLFAK; TVIGDHGDELFSVFGAPFLK; KAVEKPPQTEHIEL; NGNPNGEGLPHWPEYNQK; KFHTVPYMVGINK; EGYLQIGANTQAAQKLKDK; TAMSLLLKSYPLLHIPK; QEFGWMLPMTLISYPLSKGK 1 IPI00514011.1
441 S_Total95_2404 IPI00514020.1 |TREMBL:Q5T946 Tax_Id=9606 Glyoxylate reductase/hydroxypyruvate reductase 16 ILDAAGANLK; LPEAIEEVK; ETAVFINISR; RLPEAIEEVK; VISTMSVGIDHLALDEIK; VGYTPDVLTDTTAELAVSLLLTTCR; MKETAVFINISR; PLWLCGYGLTQSTVGIIGLGR; GVAGAHGLLCLLSDHVDK; LPEAIEEVKNGGWTSWK; GVAGAHGLLCLLSDHVDKR; NGGWTSWKPLWLCGYGLTQSTVGIIGLGR; ILDAAGANLKVISTMSVGIDHLALDEIK; PGEEPSPLLPSGDFLPRGLLVR; AADCEVEQWDSDEPIPAK; AADCEVEQWDSDEPIPAKELER 1 IPI00514020.1
442 S_Total95_2490 IPI00003836.1 |SWISS-PROT:P36537 |TREMBL:Q53GQ9; Q53GU2 |REFSEQ_NP:NP_001066 |ENSEMBL:ENSP00000265403 Tax_Id=9606 UDP-glucuronosyltransferase 2B10 precursor 16 WDQFYSEVLGR; WIPQNDLLGHPK; VDFNTMSSTDLLNALK; AVFWIEFVMR; IQHDQPVKPLDR; KWDQFYSEVLGR; ANVIATALAK; FDGNKPDALGLNTR; LEVYPTSLTK; TVINDPSYK; TEFENIIMQLVK; KADIWLMR; TEFENIIMQLVKR; DTFWLPFSQEQEILWAINDIIR; HSGGFIFPPSYVPVVMSK; FPHPFLPNVDFVGGLHCK 1 IPI00003836.1
443 S_Total95_2497 IPI00007188.4 |SWISS-PROT:P05141 |TREMBL:Q6NVC0 |REFSEQ_NP:NP_001143 |ENSEMBL:ENSP00000005593 Tax_Id=9606 ADP,ATP carrier protein, fibroblast isoform 16 DFLAGGVAAAISK; AAYFGIYDTAK; QIFLGGVDK; QIFLGGVDKR; GLYQGFNVSVQGIIIYR; YFPTQALNFAFK; YFAGNLASGGAAGATSLCFVYPLDFAR; GNLANVIR; GLGDCLVK; LLLQVQHASK; GAWSNVLR; GMGGAFVLVLYDEIK; GMGGAFVLVLYDEIKK; EQGVLSFWR; TDAAVSFAK; GTDIMYTGTLDCWR 1 IPI00007188.4
444 S_Total95_2728 IPI00301271.3 |SWISS-PROT:P04844 |REFSEQ_NP:NP_002942 |ENSEMBL:ENSP00000237531 |H-INV:HIT000031598; HIT000038762 Tax_Id=9606 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit precursor 16 TGQEVVFVAEPDNK; SIVEEIEDLVAR; FPEEEAPSTVLSQNLFTPK; LQVTNVLSQPLTQATVK; NPILWNVADVVIK; YIANTVELR; LMDHVGTEPSIK; TSFTPVGDVFELNFMNVK; EDQVIQLMNAIFSK; ASLDRPFTNLESAFYSIVGLSSLGAQVPDAK; KNFESLSEAFSVASAAAVLSHNR; LSKEETVLATVQALQTASHLSQQADLR; YHVPVVVVPEGSASDTHEQAILR; ISTEVGITNVDLSTVDKDQSIAPK; EETVLATVQALQTASHLSQQADLR; SNLDPSNVDSLFYAAQASQALSGCEISISNETK 2 IPI00411301.3, IPI00301271.3
445 S_Total95_2756 IPI00012268.2 |SWISS-PROT:Q13200 |TREMBL:Q9NSM5; Q59EG8 |REFSEQ_NP:NP_002799 |ENSEMBL:ENSP00000310129 |H-INV:HIT000026200; HIT000031345; HIT000030835; HIT000020100 Tax_Id=9606 26S proteasome non-ATPase regulatory subunit 2 16 YLYSSEDYIK; AELATEEFLPVTPILEGFVILR; AVPLALALISVSNPR; VGQAVDVVGQAGKPK; DTSLYRPALEELR; LVGSQEELASWGHEYVR; SFANTLVDVCAYAGSGNVLK; SGALLACGIVNSGVR; SETELKDTYAR; GEAIEAILAALEVVSEPFR; EDVLTLLLPVMGDSK; LAQGLTHLGK; VGQAVDVVGQAGK; DKAPVQPQQSPAAAPGGTDEKPSGK; APVQPQQSPAAAPGGTDEKPSGK; TITGFQTHTTPVLLAHGER 2 IPI00012268.2, IPI00604542.1
446 S_Total95_2770 IPI00439935.1 |SWISS-PROT:P22310 |TREMBL:Q53QD2; Q8WX88; Q8WX86; Q8WX87; Q5DT00 |REFSEQ_NP:NP_009051 Tax_Id=9606 UDP-glucuronosyltransferase 1-4 precursor, microsomal 16 AMAIADALGK; GAGVTLNVLEMTSEDLENALK; IPQTVLWR; WLPQNDLLGHPMTR; GHQAVVLTPEVNMHIK; LLTTNSDHMTFLQR; GDFVMDYPRPIMPNMVFIGGINCANGK; EVSVVDLVSYASVWLFR; CCVELLHNEALIR; GTQCPNPSSYIPK; VTLGYTQGFFETEHLLK; YLSIPAVFFWR; FFTLTAYAVPWTQK; VLVVPTDGSPWLSMR; NMLYPLALSYICHTFSAPYASLASELFQR; GHQAVVLTPEVNMHIKEEK 1 IPI00439935.1
447 S_Total95_3254 IPI00376344.3 |SWISS-PROT:O43795-1 |ENSEMBL:ENSP00000306382 Tax_Id=9606 Splice Isoform 1 of Myosin Ib 16 SEVPLVDVTK; SGVEVLFNELEIPVEEYSFGR; YLGLLENVR; ALYPSSVGQPFQGAYLEINK; EQLLQSNPVLEAFGNAK; GDPLGGVISNYLLEK; IFLLTNNNLLLADQK; SSALVIQSYIR; VNGVDDAANFR; DQDKDQCILITGESGAGK; VSTTLNVAQAYYAR; YNYLSLDSAK; EICELTGIDQSVLER; VLYQVEGFVDK; GDFLFSSDHLIEMATK; TSLLDNMIGVGDMVLLEPLNEETFINNLK 2 IPI00376344.3, IPI00414980.2
448 S_Total95_3266 IPI00083708.2 |TREMBL:Q5TI99; Q6PD54; Q9Y520; Q9H2N2 |REFSEQ_NP:NP_055987 |ENSEMBL:ENSP00000343629 |H-INV:HIT000000813; HIT000002409; HIT000020086 Tax_Id=9606 HBxAg transactivated protein 2 16 RMPPPANLPSLK; PGVAAPPEVAPAPK; STTTSDPPNICK; YATLSLFNTYKGK; EATPVVHETEPESGSQPR; ESVTDYTTPSSSLPNTVATNNTK; IEPREPNLEPMVEK; LPGQDESTAGTSEQNDILK; PSQDTEKPLEPVSTVQVEPAVK; PVQNPLQTTSQSSK; SSSQIPAQPSVAK; PAVLSGYFK; RHEQFIPIAADK; DAQQVEPEGQEKPSPATVR; SIQTPQSHGTLTAELWDNKVAPPAVLNDISK; SLETQKTTVAAR 1 IPI00083708.2
449 S_Total95_3745 IPI00298788.4 |SWISS-PROT:Q12906-1 |REFSEQ_NP:NP_036350 |ENSEMBL:ENSP00000315205 |H-INV:HIT000027440 Tax_Id=9606 Splice Isoform 1 of Interleukin enhancer-binding factor 3 16 EDITQSAQHALR; VLAGETLSVNDPPDVLDR; VPTWGPLRGWPLELLCEK; EATDAIGHLDR; NENPVDYTVQIPPSTTYAITPMK; VLECLASGIVMPDGSGIYDPCEK; GSSEQAESDNMDVPPEDDSKEGAGEQK; HSSVYPTQEELEAVQNMVSHTER; LNQLKPGLQYK; AYAALAALEK; LFPDTPLALDANK; VLQDMGLPTGAEGR; YELISETGGSHDK; AYAALAALEKLFPDTPLALDANKK; PAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTK; SGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGK 1 IPI00298788.4
450 S_Total95_3901 IPI00217223.1 |SWISS-PROT:P22234 |TREMBL:Q68CQ5 |REFSEQ_NP:NP_006443 |ENSEMBL:ENSP00000264221 |H-INV:HIT000034875; HIT000038581 Tax_Id=9606 Multifunctional protein ADE2 16 ITSCIFQLLQEAGIK; AEYEGDGIPTVFVAVAGR; EIVLADVIDNDSWR; TKEVYELLDSPGK; ASILNTWISLK; DDANNDPQWSEEQLIAAK; DLKEVTPEGLQMVK; EVYELLDSPGK; NFEWVAER; ACGNFGIPCELR; DQITAGNAAR; SWLPQNCTLVDMK; CGETAFIAPQCEMIPIEWVCR; VELFFKDDANNDPQWSEEQLIAAK; LPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSK; VVVLMGSTSDLGHCEK 1 IPI00217223.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home