Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
451 S_Total95_4152 IPI00419779.3 |TREMBL:Q6NVJ7 |REFSEQ_NP:NP_203693 |ENSEMBL:ENSP00000354283 Tax_Id=9606 Myosin IC 16 VLQALGSEPIQYAVPVVK; DGTIDFTPGSELLITK; IICDLVEEK; LGTDEISPR; LLQSNPVLEAFGNAK; NPQSYLYLVK; NVLDTSWPTPPPALR; RKYEAFLQR; TLFATEDALEVR; DQAVMISGESGAGK; VNSININQGSITFAGGPGR; GEELLSPLNLEQAAYAR; MSLLQLVEILQSK; KRPETVATQFK; GDVVLQSDHVIETLTK; FKGIISILDEECLRPGEATDLTFLEK 1 IPI00419779.3
452 S_Total95_4182 IPI00473136.2 |TREMBL:Q12795 |ENSEMBL:ENSP00000304669 Tax_Id=9606 Alpha2(E)-catenin 16 AAAGEFADDPCSSVK; AAAGEFADDPCSSVKR; IALYCHQLNICSK; WDDSGNDIIVLAK; LIEVANLACSISNNEEGVK; NTSDVISAAK; QIIVDPLSFSEER; NAGNEQDLGNQYK; KAHVLAASVEQATENFLEK; LAQENMDLFK; AHVLAASVEQATENFLEK; HVNPVQALSEFK; AIMAQLPQEQK; VLTDAVDDITSIDDFLAVSENHILEDVNK; AVMDHVSDSFLETNVPLLVLIEAAK; VIHVVTSEMDNYEPGVYTEK 1 IPI00473136.2
453 S_Total95_43 IPI00012912.1 |SWISS-PROT:P23786 |TREMBL:Q53G79; Q5SW68 |REFSEQ_NP:NP_000089 |ENSEMBL:ENSP00000287862 |H-INV:HIT000032263; HIT000030898 Tax_Id=9606 Carnitine O-palmitoyltransferase II, mitochondrial precursor 15 SFNLIIAK; AGLLEPEVFHLNPAK; DSTQTPAVTPQSQPATTDSTVTVQK; TETIRPASVYTK; YILSDSSPAPEFPLAYLTSENR; LNFELTDALK; QYGQTVATYESCSTAAFK; TLTIDCVQFQR; YLSAQKPLLNDGQFR; ELHEQLVALDK; LMSSGNEESLR; ATNMTVSAIR; ALEDMFDALEGK; GNFYIFDVLDQDGNIVSPSEIQAHLK; Comb; PMF 1 IPI00012912.1
454 S_Total95_79 IPI00402759.1 |TREMBL:Q6IB77 |REFSEQ_NP:NP_964011 |ENSEMBL:ENSP00000340200 Tax_Id=9606 Glycine-N-acyltransferase isoform a 15 DPQNCQEFLGSPELINWK; LHGLVTYVIYSHAQK; LSSMDVTHAHLVNK; QHLQIQSSQPSLNEAIQNLAAIK; VYGTVFHINHGNPFNLK; MSYTLQHVPIPR; ILYMAAETAK; SWNQWNCVPL; MAGTLPEYR; AINQEMFK; FWHFGGNER; LGFPVYSHVDYSNEAMQK; CIQTFPTCCLLGPEGTPVCWDLMDQTGEMR; WPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSK; Comb; PMF 1 IPI00402759.1
455 S_Total95_109 IPI00419585.6 |SWISS-PROT:P62937 |TREMBL:Q71V99 |REFSEQ_NP:NP_066953 |ENSEMBL:ENSP00000348240; ENSP00000351238 |H-INV:HIT000036404; HIT000032374; HIT000009843; HIT000032571; HIT000029837; HIT000033052 Tax_Id=9606 Peptidyl-prolyl cis-trans isomerase A 15 VSFELFADK; FEDENFILK; EGMNIVEAMER; IIPGFMCQGGDFTR; HTGPGILSMANAGPNTNGSQFFICTAK; SIYGEKFEDENFILK; VKEGMNIVEAMER; VSFELFADKVPK; EGMNIVEAMERFGSR; TEWLDGK; KITIADCGQLE; ITIADCGQLE; VNPTVFFDIAVDGEPLGR; TEWLDGKHVVFGK; Comb; PMF 1 IPI00419585.6
456 S_Total95_162 IPI00410714.2 |SWISS-PROT:P69905 |TREMBL:Q9NQT3; Q96T46; Q53F97; Q6J1Z9; Q86YL2; Q7Z7B4; Q7Z6G4; Q9BX83; Q86YQ5; Q4ZGM8; P78461; Q86YQ4; Q96KF1; Q9NYR7; Q86YQ1 |REFSEQ_NP:NP_000508; NP_000549 |ENSEMBL:ENSP00000251595; ENSP00000322421 |H-INV:HIT000032531; HIT000033843; HIT000041430 Tax_Id=9606 Alpha 2 globin variant 15 TYFPHFDLSHGSAQVK; VGAHAGEYGAEALER; FLASVSTVLTSK; LRVDPVNFK; MFLSFPTTK; KVADALTNAVAHVDDMPNALSALSDLHAHK; LLSHCLLVTLAAHLPAEFTPAVHASLDK; VADALTNAVAHVDDMPNALSALSDLHAHK; LLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSK; VDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDK; VGAHAGEYGAEALERMFLSFPTTK; TYFPHFDLSHGSAQVKGHGK; FLASVSTVLTSKYR; AAWGKVGAHAGEYGAEALER; Comb; PMF 1 IPI00410714.2
457 S_Total95_217 IPI00299639.4 |TREMBL:Q9NQR4 |REFSEQ_NP:NP_064587 |ENSEMBL:ENSP00000265259 |H-INV:HIT000002423 Tax_Id=9606 Nit protein 2 15 AVDNQVYVATASPAR; FAELAQIYAQR; IHLFDIDVPGK; SDLYAVEMK; LYNTCAVFGPDGTLLAK; AGTEEAIVYSDIDLK; LALIQLQISSIK; IVSLPECFNSPYGAK; KIHLFDIDVPGK; TLSPGDSFSTFDTPYCR; AGTEEAIVYSDIDLKK; ECSIYLIGGSIPEEDAGK; GCQLLVYPGAFNLTTGPAHWELLQR; ASYVAWGHSTVVNPWGEVLAK; PMF; Comb 1 IPI00299639.4
458 S_Total95_242 IPI00514561.1 |TREMBL:Q59F98; Q5T6W2; Q5T6W5 |H-INV:HIT000021240 Tax_Id=9606 Heterogeneous nuclear ribonucleoprotein K 15 IILDLISESPIK; TDYNASVSVPDSSGPER; GSYGDLGGPIITTQVTIPK; IITITGTQDQIQNAQYLLQNSVK; ILSISADIETIGEILK; GSDFDCELR; IDEPLEGSEDR; VVLIGGKPDR; IIPTLEEYQHYK; LLIHQSLAGGIIGVK; NLPLPPPPPPR; NTDEMVELR; DLAGSIIGK; RPAEDMEEEQAFK; PMF; Comb 1 IPI00514561.1
459 S_Total95_243 IPI00216746.1 |SWISS-PROT:P61978-2 |TREMBL:Q6IBN1; Q5EC54 |REFSEQ_NP:NP_112553; NP_002131 |ENSEMBL:ENSP00000353552; ENSP00000317788 |H-INV:HIT000029547 Tax_Id=9606 Splice Isoform 2 of Heterogeneous nuclear ribonucleoprotein K 15 IILDLISESPIK; TDYNASVSVPDSSGPER; GSYGDLGGPIITTQVTIPK; IITITGTQDQIQNAQYLLQNSVK; ILSISADIETIGEILK; GSDFDCELR; IDEPLEGSEDR; VVLIGGKPDR; LLIHQSLAGGIIGVK; NLPLPPPPPPR; NTDEMVELR; DLAGSIIGK; RPAEDMEEEQAFK; IIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYK; PMF; Comb 1 IPI00216746.1
460 S_Total95_281 IPI00411706.1 |SWISS-PROT:P10768 |TREMBL:Q5TBV0 |REFSEQ_NP:NP_001975 |ENSEMBL:ENSP00000267160 |H-INV:HIT000030192; HIT000018510; HIT000023370; HIT000001899 Tax_Id=9606 Esterase D 15 AFSGYLGTDQSK; AYDATHLVK; VFEHDSVELNCK; MYSYVTEELPQLINANFPVDPQR; SYPGSQLDILIDQGK; GEDESWDFGTGAGFYVDATEDPWK; SGYHQSASEHGLVVIAPDTSPR; SVSAFAPICNPVLCPWGK; CPALYWLSGLTCTEQNFISK; FAVYLPPK; DDQFLLDGQLLPDNFIAACTEK; LQEGYDHSYYFIATFITDHIR; SYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEK; DDQFLLDGQLLPDNFIAACTEKK; PMF; Comb 1 IPI00411706.1
461 S_Total95_426 IPI00010810.1 |SWISS-PROT:P13804 |TREMBL:Q53XN3 |REFSEQ_NP:NP_000117 |ENSEMBL:ENSP00000267950 |H-INV:HIT000037165 Tax_Id=9606 Electron transfer flavoprotein alpha-subunit, mitochondrial precursor 15 GLLPEELTPLILATQK; LEVAPISDIIAIK; LGGEVSCLVAGTK; ASSTSPVEISEWLDQK; LLYDLADQLHAAVGASR; TIYAGNALCTVK; DPEAPIFQVADYGIVADLFK; GTSFDAAATSGGSASSEK; AAVDAGFVPNDMQVGQTGK; QFNYTHICAGASAFGK; VLVAQHDVYK; TIVAINKDPEAPIFQVADYGIVADLFK; VKVFSVRGTSFDAAATSGGSASSEK; VVPEMTEILK; PMF; Comb 1 IPI00010810.1
462 S_Total95_458 IPI00445969.1 |TREMBL:Q6ZV71 Tax_Id=9606 Hypothetical protein FLJ42918 15 ANATEFGLASGVFTR; EGATLVCGGNQVPR; FADGDLDAVLSR; LQAGTVFVNTYNK; SPLIIFADCDLNK; KVSLELGGK; LFVEDSIHDEFVR; VGNPLDRDTDHGPQNHHAHLVK; EESFGPVMIISR; AVQMGMSSVFFNK; ALYVSDKLQAGTVFVNTYNK; PGFFFEPTVFTDVEDHMFIAK; AVQMGMSSVFFNKGENCIAAGR; CRDVALNMMAVRVR; PMF 1 IPI00445969.1
463 S_Total95_495 IPI00300026.5 |SWISS-PROT:P50225 |REFSEQ_NP:NP_001046; NP_803566; NP_803878; NP_803565 |H-INV:HIT000030007 Tax_Id=9606 Sulfotransferase 1A1 15 PDDLLISTYPK; TTFTVAQNER; DVAVSYYHFYHMAK; THLPLALLPQTLLDQK; YFAEALGPLQSFQAR; MAGCSLSFR; SGTTWVSQILDMIYQGGDLEK; YFAEALGPLQSFQARPDDLLISTYPK; VPFLEFK; FDADYAEK; THPVLYLFYEDMK; VHPEPGTWDSFLEK; KNPMTNYTTVPQEFMDHSISPFMR; SLPEETVDFMVQHTSFK; PMF; Comb 1 IPI00300026.5
464 S_Total95_501 IPI00010779.3 |SWISS-PROT:P67936-1 |TREMBL:Q9UCS4; Q5U0D9 |REFSEQ_NP:NP_003281 |ENSEMBL:ENSP00000300933 |H-INV:HIT000031219 Tax_Id=9606 Tropomyosin 4 15 IQLVEEELDR; EDKYEEEIK; KLVILEGELER; LEEAEKAADESER; LVILEGELER; RIQLVEEELDR; CGDLEEELKNVTNNLK; EENVGLHQTLDQTLNELNCI; CGDLEEELK; YSEKEDKYEEEIK; IQALQQQADEAEDR; KIQALQQQADEAEDR; EKAEGDVAALNR; AEGDVAALNR; PMF; Comb 1 IPI00010779.3
465 S_Total95_537 IPI00291419.5 |SWISS-PROT:Q9BWD1 |TREMBL:Q59GW6; Q5TCL7 |REFSEQ_NP:NP_005882 |ENSEMBL:ENSP00000239584 |H-INV:HIT000029595; HIT000011615 Tax_Id=9606 Acetyl-CoA acetyltransferase, cytosolic 15 EIVPVLVSTR; ATVAPEDVSEVIFGHVLAAGCGQNPVR; TIIGSFNGALAAVPVQDLGSTVIK; VNIEGGAIALGHPLGASGCR; AGHFDKEIVPVLVSTR; ILVTLLHTLER; IVSWSQVGVEPSIMGIGPIPAIK; WQVSREDQDK; AGWSLEDVDIFEINEAFAAVSAAIVK; VAVLSQNR; LKPYFLTDGTGTVTPANASGINDGAAAVVLMK; TIIGSFNGALAAVPVQDLGSTVIKEVLKR; IGEMPLTDSILCDGLTDAFHNCHMGITAENVAK; APHLAYLR; PMF; Comb 1 IPI00291419.5
466 S_Total95_612 IPI00004902.1 |SWISS-PROT:P38117 |TREMBL:Q6IBH7 |REFSEQ_NP:NP_001976 |ENSEMBL:ENSP00000311930 |H-INV:HIT000028117 Tax_Id=9606 Electron transfer flavoprotein beta-subunit 15 GIHVEVPPAEAER; EIDGGLETLR; VETTEDLVAK; IEVIKPGDLGVDLTSK; EVIAVSCGPAQCQETIR; LGPLQVAR; LKLPAVVTADLR; LPAVVTADLR; LSVISVEDPPQR; VDLVLLGK; EKVDLVLLGK; HSMNPFCEIAVEEAVR; KIEVIKPGDLGVDLTSK; QAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDK; PMF; Comb 1 IPI00004902.1
467 S_Total95_613 IPI00556451.1 |TREMBL:Q71RF6 |REFSEQ_NP:NP_001014763 |H-INV:HIT000011899 Tax_Id=9606 FP585 15 GIHVEVPPAEAER; EIDGGLETLR; VETTEDLVAK; IEVIKPGDLGVDLTSK; EVIAVSCGPAQCQETIR; LGPLQVAR; LKLPAVVTADLR; LPAVVTADLR; LSVISVEDPPQR; VDLVLLGK; EKVDLVLLGK; HSMNPFCEIAVEEAVR; KIEVIKPGDLGVDLTSK; QAIDDDCNQTGQMTAGFLDWPQGTFASQVMLEGDK; PMF; Comb 1 IPI00556451.1
468 S_Total95_614 IPI00293721.3 |SWISS-PROT:O95154 |REFSEQ_NP:NP_036199 |ENSEMBL:ENSP00000062030 |H-INV:HIT000039976; HIT000041312 Tax_Id=9606 Aflatoxin B1 aldehyde reductase member 3 15 QVETELFPCLR; EHHFEGIALVEK; FYAFNPLAGGLLTGK; AIPLFGNSLKPDSLR; FFGNTWAEMYR; GHTEIDTAFVYSEGQSETILGGLGLR; RMDAPTSAAVTR; VDLFYLHMPDHSTPVEETLR; ALQAAYGASAPSMTSATLR; FQLETSLKR; MDAPTSAAVTR; ARPATVLGAMEMGR; PATVLGAMEMGR; GHTEIDTAFLYSDGQSETILGGLGLR; PMF; Comb 1 IPI00293721.3
469 S_Total95_649 IPI00003482.1 |SWISS-PROT:Q16698 |TREMBL:Q7LDK6 |REFSEQ_NP:NP_001350 |ENSEMBL:ENSP00000220764 Tax_Id=9606 2,4-dienoyl-CoA reductase, mitochondrial precursor 15 EQWDTIEELIR; FNVIQPGPIK; VAFITGGGTGLGK; ATAEQISSQTGNK; AMLPPNSFQGK; FDGGEEVLISGEFNDLR; GAAFLSITTIYAETGSGFVVPSASAK; LGTVEELANLAAFLCSDYASWINGAVIK; TITDIVLNGTAFVTLEIGK; VAGHPNIVINNAAGNFISPTER; GMTTLLSSLGAQCVIASR; DPDMVQNTVSELIK; ILYQNTEALQSK; FDGGEEVLISGEFNDLRK; PMF; Comb 1 IPI00003482.1
470 S_Total95_662 IPI00292858.4 |SWISS-PROT:P19971 |REFSEQ_NP:NP_001944 |ENSEMBL:ENSP00000352279; ENSP00000252029 |H-INV:HIT000038301 Tax_Id=9606 Thymidine phosphorylase precursor 15 DVTATVDSLPLITASILSK; ALPLALVLHELGAGR; DLVTTLGGALLWLSGHAGTQAQGAAR; VAAALDDGSALGR; ALQEALVLSDR; FGGAAVFPNQEQAR; VSLVLAPALAACGCK; EQEELLAPADGTVELVR; MLAAQGVDPGLAR; DVTATVDSLPLITASILSKK; LGVGAELLVDVGQR; AREQEELLAPADGTVELVR; GMDLEETSVLTQALAQSGQQLEWPEAWR; VAAALTAMDKPLGR; Comb; PMF 1 IPI00292858.4
471 S_Total95_726 IPI00001466.2 |SWISS-PROT:Q9HC35 |TREMBL:Q53TW8; Q9NV40; Q53R29; Q6PJ45 |REFSEQ_NP:NP_061936 |ENSEMBL:ENSP00000320663 |H-INV:HIT000013494; HIT000004278; HIT000027304 Tax_Id=9606 Echinoderm microtubule-associated protein-like 4 15 ATLLEDQQDPSPSS; DVIINQEGEYIK; ADQFLVGTSR; KEESHSNDQSPQIR; LKLEWAYGYR; LSLPQNETVADTTLTK; VQQQEDEITVLK; EIEVPDQYGTIR; IATGQIAGVDK; WFVLDAETR; AALADVLR; IILWDHDLNPER; LAISEDHVASVK; APVSSTESVIQSNTPTPPPSQPLNETAEEESR; ASPSPQPSSQPLQIHR 1 IPI00001466.2
472 S_Total95_801 IPI00010720.1 |SWISS-PROT:P48643 |TREMBL:Q9BU08; Q96GI1; Q9HB74 |REFSEQ_NP:NP_036205 |ENSEMBL:ENSP00000280326 |H-INV:HIT000042255; HIT000032913 Tax_Id=9606 T-complex protein 1, epsilon subunit 15 SIHDALCVIR; HKLDVTSVEDYK; IAILTCPFEPPKPK; WVGGPEIELIAIATGGR; ISDSVLVDIKDTEPLIQTAK; LGFAGLVQEISFGTTK; LDVTSVEDYK; GGNKMIIEEAKR; SQDDEIGDGTTGVVVLAGALLEEAEQLLDR; EMNPALGIDCLHK; ISDSVLVDIK; VVYGGGAAEISCALAVSQEADK; ETGANLAICQWGFDDEANHLLLQNNLPAVR; DGDVTVTNDGATILSMMDVDHQIAK; PMF; Comb 1 IPI00010720.1
473 S_Total95_1013 IPI00220906.4 |SWISS-PROT:P49753-1 |TREMBL:Q53EK4 |REFSEQ_NP:NP_006812 |ENSEMBL:ENSP00000238651 |H-INV:HIT000032880; HIT000004413; HIT000032766; HIT000031942 Tax_Id=9606 Splice Isoform 1 of Peroxisomal acyl-coenzyme A thioester hydrolase 2a 15 ADTLGELDLER; GLAPEQPVTLR; DGYADIVDVLNSPLEGPDQK; TPLAVELEVLDGHDPDPGR; YKGETLPPVGVNR; CCWDEPVR; AESTFLFLVGQDDHNWK; ASLHALVGSPIIWGGEPR; GPGVGLLGISK; SEFYANEACK; GTLFLPPEPGPFPGIVDMFGTGGGLLEYR; KPQIICYPETGHYIEPPYFPLCR; YFLPPGVR; TMETLHLEYFEEAMNYLLSHPEVK; Comb; PMF 1 IPI00220906.4
474 S_Total95_1061 IPI00219649.2 |SWISS-PROT:P35520-2 |ENSEMBL:ENSP00000344460 |H-INV:HIT000029626 Tax_Id=9606 Cystathionine beta-synthase 15 SNDEEAFTFAR; FDSPESHVGVAWR; LKNEIPNSHILDQYR; NASNPLAHYDTTADEILQQCDGK; DGTLKPGDTIIEPTSGNTGIGLALAAAVR; CVVILPDSVR; CEFFNAGGSVK; LDMLVASVGTGGTITGIARKLK; AAQELQEGQR; CIIVMPEK; VQELGLSAPLTVLPTITCGHTIEILR; KPWWWHLR; IIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDR; QMVFGVVTAIDLLNFVAAQER; Comb; PMF 2 IPI00219352.3, IPI00219649.2
475 S_Total95_1068-1 IPI00515042.1 |SWISS-PROT:Q9P2M7 |REFSEQ_NP:NP_065821 |ENSEMBL:ENSP00000355219 |H-INV:HIT000001034 Tax_Id=9606 Cingulin 15 GLVDGGEAVEAR; LDKELLAQR; LLDQGEDLR; VASPGSTIDTAPLSSVDSLINK; HGLETQVMELQNK; MEKEEMEEELGEK; VQGIAGQPFVVLNSGEK; GKAELEEQK; GANDQGASGALSSDLELPENPYSQVK; ELEEQNLQLQK; ELLEEVLEGK; FITEPVSGAEMGTLR; KGEAQQSNKELQNMK; LQGLEQEAENK; PMF 1 IPI00515042.1
476 S_Total95_1068-2 IPI00218136.2 |ENSEMBL:ENSP00000271636 Tax_Id=9606 137 kDa protein 15 GLVDGGEAVEAR; LDKELLAQR; LLDQGEDLR; VASPGSTIDTAPLSSVDSLINK; HGLETQVMELQNK; MEKEEMEEELGEK; VQGIAGQPFVVLNSGEK; GKAELEEQK; GANDQGASGALSSDLELPENPYSQVK; ELEEQNLQLQK; ELLEEVLEGK; FITEPVSGAEMGTLR; KGEAQQSNKELQNMK; LQGLEQEAENK; PMF 1 IPI00218136.2
477 S_Total95_1095 IPI00017297.1 |SWISS-PROT:P43243 |TREMBL:Q9H4N1; Q68D11; Q5CZA7 |REFSEQ_NP:NP_954659; NP_061322 |ENSEMBL:ENSP00000354346; ENSP00000338208 |H-INV:HIT000014255; HIT000003862; HIT000036972; HIT000000448 Tax_Id=9606 Matrin 3 15 ITPENLPQILLQLK; GDADQASNILASFGLSAR; IGPYQPNVPVGIDYVIPK; TEEGPTLSYGR; YQLLQLVEPFGVISNHLILNK; LCSLFYTNEEVAK; IEELDQENEAALENGIK; NEENTEPGAESSENADDPNK; EDAMAMVDHCLK; GPSLNPVLDYDHGSR; LASLMNLGMSSSLNQQGAHSALSSASTSSHNLQSIFNIGSR; GAPPSSNIEDFHGLLPK; KRGAPPSSNIEDFHGLLPK; GNLGAGNGNLQGPR; Comb; PMF 1 IPI00017297.1
478 S_Total95_1108 IPI00329801.10 |SWISS-PROT:P08758 |TREMBL:Q6FHB3 |REFSEQ_NP:NP_001145 |ENSEMBL:ENSP00000296511 |H-INV:HIT000032140; HIT000035976; HIT000038395; HIT000030406; HIT000035961 Tax_Id=9606 Annexin V 15 ALLLLCGEDD; ETSGNLEQLLLAVVK; GLGTDEESILTLLTSR; DPDAGIDEAQVEQDAQALFQAGELK; DLLDDLKSELTGK; FITIFGTR; LYDAYELK; NFATSLYSMIK; QVYEEEYGSSLEDDVVGDTSGYYQR; VLTEIIASR; GTVTDFPGFDER; FEKLIVALMKPSR; MLVVLLQANR; SIPAYLAETLYYAMK; Comb; PMF 1 IPI00329801.10
479 S_Total95_1208 IPI00171903.1 |SWISS-PROT:P52272-1 |TREMBL:Q59ES8; Q7KYM9 |REFSEQ_NP:NP_005959 |ENSEMBL:ENSP00000325376 |H-INV:HIT000038663 Tax_Id=9606 Heterogeneous nuclear ribonucleoprotein M isoform a 15 GNFGGSFAGSFGGAGGHAPGVAR; AFITNIPFDVK; VGEVTYVELLMDAEGK; MGSGVERMGPAIER; QGGGGGGGSVPGIER; ACQIFVR; MGPAMGPALGAGIER; GIGMGNIGPAGMGMEGIGFGINK; MGGMEGPFGGGMENMGR; MGAGMGFGLER; MGLAMGGGGGASFDR; MGPLGLDHMASSIER; DKFNECGHVLYADIK; MEEESGAPGVPSGNGAPGPK; PMF; Comb 1 IPI00171903.1
480 S_Total95_1328 IPI00024664.1 |SWISS-PROT:P45974-1 |ENSEMBL:ENSP00000229268 |H-INV:HIT000032241 Tax_Id=9606 Splice Isoform Long of Ubiquitin carboxyl-terminal hydrolase 5 15 FASFPDYLVIQIK; KQEVQAWDGEVR; DGLGGLPDIVR; IFQNAPTDPTQDFSTQVAK; VTSAVEALLSADSASR; EEDPATGTGDPPR; ENLWLNLTDGSILCGR; SAADSISESVPVGPK; SSENPNEVFR; IVILPDYLEIAR; VDYIMQLPVPMDAALNK; LGHGLLSGEYSKPVPESGDGERVPEQK; IGEWELIQESGVPLKPLFGPGYTGIR; GTGLQPGEEELPDIAPPLVTPDEPK; PMF; Comb 2 IPI00024664.1, IPI00375145.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home