Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
481 S_Total95_1341 IPI00018140.2 |SWISS-PROT:O60506-1 |TREMBL:Q5TCG2; Q53H05; Q5TCG3 |REFSEQ_NP:NP_006363 |ENSEMBL:ENSP00000257767 Tax_Id=9606 Splice Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 15 DLFEDELVPLFEK; NLANTVTEEILEK; AGPIWDLR; VTEGLTDVILYHQPDDK; GYAFVTFCTK; TKEQILEEFSK; HIGVCISVANNR; LMMDPLTGLNR; TGYTLDVTTGQR; SAFLCGVMK; EFNEDGALAVLQQFK; VADSSKGPDEAKIK; YGGPPPDSVYSGQQPSVGTEIFVGK; SENQEFYQDTFGQQWK; Comb; PMF 2 IPI00018140.2, IPI00402182.1
482 S_Total95_1374 IPI00028091.1 |SWISS-PROT:P61158 |TREMBL:Q53QM2; Q59FV6 |REFSEQ_NP:NP_005712 |ENSEMBL:ENSP00000263238 |H-INV:HIT000027685 Tax_Id=9606 Actin-like protein 3 15 DITYFIQQLLR; KDYEEIGPSICR; LGYAGNTEPQFIIPSCIAIK; TLTGTVIDSGDGVTHVIPVAEGYVIGSCIK; DREVGIPPEQSLETAK; GVDDLDFFIGDEAIEKPTYATK; KEFSIDVGYER; AEPEDHYFLLTEPPLNTPENR; DYEEIGPSICR; YSYVCPDLVK; NIVLSGGSTMFR; LPACVVDCGTGYTK; HGIVEDWDLMER; FLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVR; Comb; PMF 1 IPI00028091.1
483 S_Total95_1379 IPI00304596.2 |SWISS-PROT:Q15233 |REFSEQ_NP:NP_031389 |ENSEMBL:ENSP00000298087 |H-INV:HIT000031450; HIT000035689; HIT000040516; HIT000034765; HIT000030831 Tax_Id=9606 Non-POU domain-containing octamer-binding protein 15 NLPQYVSNELLEEAFSVFGQVER; CSEGSFLLTTFPR; FACHSASLTVR; MEELHNQEVQKRK; LEMEMEAAR; VELDNMPLR; EKLEMEMEAAR; FAQPGSFEYEYAMR; FGQAATMEGIGAIGGTPPAFNR; LFVGNLPPDITEEEMR; MEELHNQEVQK; MGQMAMGGAMGINNR; PVTVEPMDQLDDEEGLPEK; RMEELHNQEVQK; Comb; PMF 1 IPI00304596.2
484 S_Total95_1399 IPI00023785.4 |SWISS-PROT:Q92841 |TREMBL:Q69YT1; Q59F66; Q6ICD6 |REFSEQ_NP:NP_006377 |ENSEMBL:ENSP00000216019 |H-INV:HIT000026686; HIT000008259; HIT000029762; HIT000015004 Tax_Id=9606 DEAD box polypeptide 17 isoform p82 15 MLDMGFEPQIR; APILIATDVASR; VLEEANQAINPK; ELAQQVQQVADDYGK; NFYVEHPEVAR; SSQSSSQQFSGIGR; GTAYTFFTPGNLK; LIQLMEEIMAEK; WDLSELPK; APLPDLYPFGTMR; DWVLNEFR; GDGPICLVLAPTR; TTSSANNPNLMYQDECDR; FVINYDYPNSSEDYVHR; Comb; PMF 1 IPI00023785.4
485 S_Total95_1458 IPI00239406.1 |SWISS-PROT:Q8WXH0-2 |TREMBL:Q6MZP0 |ENSEMBL:ENSP00000350719 Tax_Id=9606 Splice Isoform 2 of Nesprin 2 15 LWQKFLDDYSR; QWQDFTTSVENLFR; TSLQQSLNEISGQSVAEQLQK; EDGSGQQVHYETLALELK; TRPEPTEVLHACK; KMEEDIYTNLSK; KLVSKTQLEMNLPLMIK; AVEELKNNVTEDIK; ESLMVLNSSEGKMPLEERIQK; KAAIKPLEQTECLNK; EAIILDNLQEELPEISK; DVCAKWESLHHELSLYVQQLKIDIEK; SILTTLIQKEESVISLQASYMGKENLK; FVSEEIEREAIILDNLQEELPEISKTK; PMF 2 IPI00239405.3, IPI00239406.1
486 S_Total95_1616 IPI00025273.1 |SWISS-PROT:P22102-1 |TREMBL:Q15374; O14659; Q59HH3; Q71VH3 |REFSEQ_NP:NP_000810 |ENSEMBL:ENSP00000290230 Tax_Id=9606 Splice Isoform Long of Trifunctional purine biosynthetic protein adenosine-3 15 AIAFLQQPR; VDLGGFAGLFDLK; AAGFKDPLLASGTDGVGTK; ESGVDIAAGNMLVKK; FGDPECQVILPLLK; QVLVAPGNAGTACSEK; SAGVQCFGPTAEAAQLESSK; IEFVVVGPEAPLAAGIVGNLR; NGKVVTHGGRVLAVTAIR; MLNIHPSLLPSFK; AERAGIPTRVINHK; IYSHSLLPVLR; AFAHITGGGLLENIPR; IFPAALQLVASGTVQLGENGK; PMF 1 IPI00025273.1
487 S_Total95_1740 IPI00448751.2 |TREMBL:Q68DG1 |H-INV:HIT000016445; HIT000039490 Tax_Id=9606 Hypothetical protein DKFZp686A0439 15 ATQPETTEEVTDLKR; TLEAEFNSPSPPTPEPGEGPR; VTAEADSSSPTGILATSESK; EKATQPETTEEVTDLK; SLDPENSETELER; ATQPETTEEVTDLK; DQIVSVQEEK; KEKATQPETTEEVTDLK; ELEEQLENETLHK; KYIDGEKQAEPVVVLDPVSTHEPQTK; EDEGEIQPENK; VTFQPPSSIGCR; DQVAEKDPTQHKEDEGEIQPENK; QAEPVVVLDPVSTHEPQTK; Comb; PMF 1 IPI00448751.2
488 S_Total95_2056 IPI00025491.1 |SWISS-PROT:P60842 |TREMBL:Q9NZR9 |REFSEQ_NP:NP_001407 |ENSEMBL:ENSP00000293831 |H-INV:HIT000034452 Tax_Id=9606 Eukaryotic initiation factor 4A-I 15 GYDVIAQAQSGTGK; GIYAYGFEKPSAIQQR; KEELTLEGIR; MFVLDEADEMLSR; RKVDWLTEK; TATFAISILQQIELDLK; LNSNTQVVLLSATMPSDVLEVTK; DNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLR; VLITTDLLAR; GIDVQQVSLVINYDLPTNR; GVAINMVTEEDKR; KGVAINMVTEEDKR; DIETFYNTSIEEMPLNVADLI; DFTVSAMHGDMDQK; PMF 1 IPI00025491.1
489 S_Total95_2061 IPI00216318.4 |SWISS-PROT:P31946 |REFSEQ_NP:NP_003395; NP_647539 |ENSEMBL:ENSP00000300161; ENSP00000217069 |H-INV:HIT000028900; HIT000030345 Tax_Id=9606 14-3-3 protein beta/alpha 15 DSTLIMQLLR; VISSIEQK; NLLSVAYK; AVTEQGHELSNEER; YDDMAAAMK; YLIPNATQPESK; YLSEVASGDNK; QTTVSNSQQAYQEAFEISK; IEAELQDICNDVLELLDK; TAFDEAIAELDTLNEESYK; YLIPNATQPESKVFYLK; DNLTLWTSENQGDEGDAGEGEN; EKIEAELQDICNDVLELLDK; QTTVSNSQQAYQEAFEISKK; PMF 1 IPI00216318.4
490 S_Total95_2357 IPI00018314.1 |SWISS-PROT:O76054-1 |TREMBL:Q53EQ2 |REFSEQ_NP:NP_036561 |ENSEMBL:ENSP00000316203 |H-INV:HIT000016269 Tax_Id=9606 Splice Isoform 1 of SEC14-like protein 2 15 FDNTYSFIHAK; ENVQDVLPALPNPDDYFLLR; AGEMTEVLPNQR; FRENVQDVLPALPNPDDYFLLR; INYGGDIPR; ECELLLQECAHQTTK; KVETITIIYDCEGLGLK; KVNFTVEVLLPDK; YNSHLVPEDGTLTCSDPGIYVLR; GSSHQVEYEILFPGCVLR; HISPDQVPVEYGGTMTDPDGNPK; PAVEAYGEFLCMFEENYPETLK; WQFMSDGADVGFGIFLK; SKINYGGDIPR; Comb 1 IPI00018314.1
491 S_Total95_2376 IPI00455462.1 |REFSEQ_XP:XP_496418 Tax_Id=9606 PREDICTED: similar to KRT8 protein 15 LSELEAALQR; DVDEAYMNK; NKYEDEINKR; LEAELGNMQGLVEDFK; LESGMQNMSIHTK; WSLLQQQK; DVDEAYMNKVELESR; TLNNKFASFIDKVR; FASFIDK; QLYEEEIR; LKLEAELGNMQGLVEDFK; TLNNKFASFIDK; KLLEGEESR; FASFIDKVR; ASLEAAIADAQQR 1 IPI00455462.1
492 S_Total95_2487 IPI00029784.3 |SWISS-PROT:P16662 |TREMBL:Q9HCT7; Q5QKR3; Q99912; Q6GTW0 |REFSEQ_NP:NP_001065 |ENSEMBL:ENSP00000304811 |H-INV:HIT000041182 Tax_Id=9606 UDP-glucuronosyltransferase 2B7 precursor 15 ANVIASALAKIPQK; IEIYPTSLTK; TILDELIQR; WDQFYSEVLGR; WIPQNDLLGHPK; FDGNKPDTLGLNTR; TELENFIMQQIK; ADVWLIR; VDFNTMSSTDLLNALK; AVFWIEFVMR; IQHDQPVKPLDR; NSWNFQFPHPLLPNVDFVGGLHCK; KWDQFYSEVLGR; HSGGFIFPPSYVPVVMSELTDQMTFMER; VDFNTMSSTDLLNALKR 1 IPI00029784.3
493 S_Total95_2725 IPI00099595.1 |TREMBL:O14756 |REFSEQ_NP:NP_003716 |ENSEMBL:ENSP00000318631 |H-INV:HIT000038909 Tax_Id=9606 Oxidoreductase 15 LETVTLDVTK; GQTSDRLETVTLDVTK; VLAACLTEK; YGVEAFSDILR; FFFIPLSYLPTSLADYILTR; YVFITGCDSGFGNLLAR; ISIVEPGYFR; MESIAAATQWVK; TGMTNMTQSLER; ETYGQQYFDALYNIMK; EGLLNCSTNLNLVTDCMEHALTSVHPR; EGLLNCSTNLNLVTDCMEHALTSVHPRTR; TRYSAGWDAKFFFIPLSYLPTSLADYILTR; VAFFVGGYCVSK; IVNVSSILGR 1 IPI00099595.1
494 S_Total95_2779 IPI00002372.1 |SWISS-PROT:P28288 |REFSEQ_NP:NP_002849 |ENSEMBL:ENSP00000263889 Tax_Id=9606 ATP-binding cassette, sub-family D, member 3 15 DLNFEVR; EYLDNVQLGHILER; IANPDQLLTQDVEK; KGISDLVLK; SGANVLICGPNGCGK; ERAVVDKVFFSR; GIEGVQVIPLIPGAGEIIIADNIIK; EGGWDSVQDWMDVLSGGEK; VLGELWPLFGGR; YLYEEYLQAFTYYK; DQVIYPDGR; NSSLAGAAFLLLCLLHK; KVGITLFTVSHR; STHSELLEDYYQSGR; LVEHLHNFILFR 1 IPI00002372.1
495 S_Total95_2828 IPI00017375.1 |SWISS-PROT:Q15436 |REFSEQ_NP:NP_006355 |ENSEMBL:ENSP00000306881 |H-INV:HIT000026027 Tax_Id=9606 Protein transport protein Sec23A 15 ISGAIGPCVSLNSK; FGEYHKDDPSSFR; GAIQFVTQYQHSSGQR; HLLQAPVDDAQEILHSR; SSFLQVFNNSPDESSYYR; DLSAKQLQEMLGLSK; ERPDLPPIQYEPVLCSR; IDMNLTDLLGELQR; AETEEGPDVLR; AVLNPLCQVDYR; GPQVQQPPPSNR; LWACNFCYQR; MVVPVAALFTPLK; GPCVSENEIGTGGTCQWK; NWADAQTQIQNIAASFDQEAAAILMAR 1 IPI00017375.1
496 S_Total95_2978 IPI00215638.2 |SWISS-PROT:Q08211 |TREMBL:Q58F26; Q5VY62; Q6PJK6; Q6PD69 |REFSEQ_NP:NP_001348 |ENSEMBL:ENSP00000310700 |H-INV:HIT000021437 Tax_Id=9606 ATP-dependent RNA helicase A 15 EGETVEPYK; ETPFELIEALLK; KVFDPVPVGVTK; DVVQAYPEVR; ELDALDANDELTPLGR; LAAQSCALSLVR; TTQVPQFILDDFIQNDR; LAQFEPSQR; DINTDFLLVVLR; LGGIGQFLAK; VQSDGQIVLVDDWIK; DKDDDGGEDDDANCNLICGDEYGPETR; YIETLNVPGAVLVFLPGWNLIYTMQK; NELMYQLEQDHDLQAILQER; GISHVIVDEIHER 1 IPI00215638.2
497 S_Total95_3048 IPI00479217.1 |TREMBL:Q7Z4Q5; Q8N174; Q9BQ09; Q5RI18; Q9UEL2; Q96BA7; Q5RI17; Q5RI19 |REFSEQ_NP:NP_004492 |ENSEMBL:ENSP00000283179 |H-INV:HIT000037320; HIT000039837; HIT000031521; HIT000031649 Tax_Id=9606 Heterogeneous nuclear ribonucleoprotein U, isoform b 15 NGQDLGVAFK; NFILDQTNVSAAAQR; GGFNMRGGNFRGGAPGNR; GYFEYIEENK; LLEQYKEESKK; SSGPTSLFAVTVAPPGAR; YNILGTNTIMDK; MMVAGFKKQMADTGK; GGGGGGSGGIGYPYPR; KDCEVVMMIGLPGAGK; LQAALDDEEAGGR; EKPYFPIPEEYTFIQNVPLEDR; GNFTLPEVAECFDEITYVELQK; LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR; PAMEPGNGSLDLGGDSAGR 1 IPI00479217.1
498 S_Total95_3158 IPI00302927.5 |SWISS-PROT:P50991 |TREMBL:Q53QP9 |REFSEQ_NP:NP_006421 |ENSEMBL:ENSP00000233836 Tax_Id=9606 T-complex protein 1, delta subunit 15 SGATAGAAGGRGK; DALSDLALHFLNK; LGGTIDDCELVEGLVLTQK; SIHDALCVIR; ALIAGGGAPEIELALR; AQDIEAGDGTTSVVIIAGSLLDSCTK; AYILNLVK; ETLLNSATTSLNSK; GDVTITNDGATILK; TGCNVLLIQK; VIDPATATSVDLR; TDMDNQIVVSDYAQMDR; AFADAMEVIPSTLAENAGLNPISTVTELR; GIHPTIISESFQK; MIQDGKGDVTITNDGATILK 1 IPI00302927.5
499 S_Total95_3454 IPI00554711.1 |SWISS-PROT:P14923 |TREMBL:Q7KZ86; Q7L3S5; Q15151; Q9BWC4; Q86W21 |REFSEQ_NP:NP_068831; NP_002221 |ENSEMBL:ENSP00000308144; ENSP00000311113; ENSP00000350485 |H-INV:HIT000035502 Tax_Id=9606 Junction plakoglobin 15 ISEDKNPDYR; LNTIPLFVQLLYSSVENIQR; VAAGVLCELAQDK; HVAAGTQQPYTDGVR; TLVTQNSGVEALIHAILR; AGDKDDITEPAVCALR; LVQNCLWTLR; NKTLVTQNSGVEALIHAILR; NLALCPANHAPLQEAAVIPR; AQKMVPLLNKNNPK; LLNDEDPVVVTK; LNYGIPAIVK; MEEIVEGCTGALHILAR; ALMGSPQLVAAVVR; TMQNTSDLDTAR 1 IPI00554711.1
500 S_Total95_3545 IPI00456699.2 |TREMBL:Q6NWU0; Q6B012 |REFSEQ_NP:NP_000097 |ENSEMBL:ENSP00000351927 Tax_Id=9606 Cytochrome P450, subfamily IID, polypeptide 6 15 AVSNVIASLTCGR; EVLNAVPVLLHIPALAGK; VQQEIDDVIGQVR; DEAVWEKPFR; DIEVQGFR; RFSVSTLR; GTTLITNLSSVLK; LLDLAQEGLK; LLDLAQEGLKEESGFLR; AFLTQLDELLTEHR; FGDIVPLGVTHMTSR; RPEMGDQAHMPYTTAVIHEVQR; GNPESSFNDENLR; EALVTHGEDTADRPPVPITQILGFGPR; YPPGPLPLPGLGNLLHVDFQNTPYCFDQLR 1 IPI00456699.2
501 S_Total95_3619 IPI00031479.1 |SWISS-PROT:Q14554 |REFSEQ_NP:NP_006801 |ENSEMBL:ENSP00000323313 |H-INV:HIT000011577 Tax_Id=9606 Protein disulfide-isomerase A5 precursor 15 AAEALHGEADSSGVLAAVDATVNK; DVVHLDSEKDFR; FHISEFPTLK; LLSTVAQAVK; VELFHYQDGAFHTEYNR; GQGTICWVDCGDAESR; GYPTFHYYHYGK; IACAAVDCVK; NQDLCQQEAVK; TELGFTNYIR; FLFQYDNYGSTAEDIVEWLK; DKNQDLCQQEAVK; GPPLWEEDPGAK; FLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFR; NPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVK 1 IPI00031479.1
502 S_Total95_3639 IPI00515009.1 |SWISS-PROT:O15320-4 Tax_Id=9606 Splice Isoform 5B of Cutaneous T-cell lymphoma-associated antigen 5 15 AFLSPPTLLEGPLR; AKDLEEELER; SPPGAGAPASGRGLGGPQK; ISHATEELETYR; DALNENSQLQESQK; EATEAQSLEATCEK; DPYALDVPNTAFGR; LTETELKFELLEK; VMTELYQENEMK; GPGNPLDHQITNER; MMFPPPGQSYPDSALPPQR; VHAEQVLNDKESHIK; NLQTEQASLQSENTHFENENQK; EHSPYGPSPLGWPSSETR; TIHSYQGQIISHEK 1 IPI00515009.1
503 S_Total95_3710 IPI00006207.1 |TREMBL:O75766; Q53T49 |REFSEQ_NP:NP_004726 |ENSEMBL:ENSP00000244815 Tax_Id=9606 TRIP protein 15 DHNEEEGEETGLRDEKPIK; SDQQGEALDSSQKKTK; IDGATQSSPAEPK; IAAESSENVDCPENPK; SAVEAQNEVTENPK; AGGEELDEGVAK; AMVSNAQLDNEK; DCVDIEVFPAGENTEDQK; ALDSNSLENDDLSAPGR; DSLAEVEEK; ELTYQNTDLSEIK; ELTYQNTDLSEIKEEEQVK; TNFMYQVDTLK; DHNEEEGEETGLR; TEVPGSPAGTEGNCQEATGPSTVDTQNEPLDMK 2 IPI00382733.1, IPI00006207.1
504 S_Total95_3733 IPI00184848.2 |SWISS-PROT:O95342 |TREMBL:Q53TL2; Q53S60; Q9UIL3 |REFSEQ_NP:NP_003733 |ENSEMBL:ENSP00000263817 Tax_Id=9606 Bile salt export pump 15 DQIGIVEQEPVLFSTTIAENIR; ILLLDEATSALDTESEK; AAATSIFETIDR; FGEENDGFESDKSYNNDK; VGFFQLFR; YGREDATMEDIVQAAK; STSIQLLER; YETNVGSQGSQLSR; STALQLIQR; AMLGQDIAWFDDLR; IQHGHTIISVAHR; FIEALETELEKPFK; ILLLDEATSALDTESEKTVQVALDK; ILLLDMATSALDNESEAMVQEVLSK; DKDIPVQEEVEPAPVR 1 IPI00184848.2
505 S_Total95_3746 IPI00556173.1 |SWISS-PROT:Q12906-6 Tax_Id=9606 Splice Isoform 6 of Interleukin enhancer-binding factor 3 15 EDITQSAQHALR; VLAGETLSVNDPPDVLDR; VPTWGPLRGWPLELLCEK; EATDAIGHLDR; NENPVDYTVQIPPSTTYAITPMK; VLECLASGIVMPDGSGIYDPCEK; GSSEQAESDNMDVPPEDDSKEGAGEQK; HSSVYPTQEELEAVQNMVSHTER; LNQLKPGLQYK; AYAALAALEK; LFPDTPLALDANK; PAVVAPAPVVEAVSTPSAAFPSDATAENVK; VLQDMGLPTGAEGR; YELISETGGSHDK; AYAALAALEKLFPDTPLALDANKK 2 IPI00556173.1, IPI00418313.2
506 S_Total95_3799 IPI00019580.1 |SWISS-PROT:P00747 |TREMBL:Q5TEH5; Q5TEH4; Q9UMI2 |REFSEQ_NP:NP_000292 |ENSEMBL:ENSP00000241669 Tax_Id=9606 Plasminogen precursor 15 FSPATHPSEGLEENYCR; HSIFTPETNPR; NPDGDVGGPWCYTTNPR; NPDNDPQGPWCYTTDPEK; QLGAGSIEECAAK; TECFITGWGETQGTFGAGLLK; VIPACLPSPNYVVADR; CTTPPPSSGPTYQCLK; EQQCVIMAENR; WSSTSPHRPR; YILQGVTSWGLGCAR; FVTWIEGVMR; LYDYCDVPQCAAPSFDCGKPQVEPK; VQSTELCAGHLAGGTDSCQGDSGGPLVCFEK; VVGGCVAHPHSWPWQVSLR 1 IPI00019580.1
507 S_Total95_3948 IPI00555994.1 |TREMBL:Q59FH8 |H-INV:HIT000006619 Tax_Id=9606 Diaphanous 1 variant 15 LGLHQVLQDLR; LVAEDLSQDCFWTK; NAGAFGFNISFLCK; QDLEAEVSQLTGEVAK; NSETFPTILEEAK; TAQNLSIFLGSFR; TMLETEEGILLLVR; SPDELPSAGGDGGK; DVQNFPAATDEK; MEMDDFNEVFQILLNTVK; AEPHFLSILQHLLLVR; AGCAVTSLLASELTK; LIEECISQIVLHK; VSLNNNPVSWVQTFGAEGLASLLDILK; EQLIDMNAEGDETGVMDSLLEALQSGAAFR 2 IPI00030876.3, IPI00555994.1
508 S_Total95_3959 IPI00456853.3 |TREMBL:Q9Y4E1; Q5SQU5 |REFSEQ_NP:NP_056077 |ENSEMBL:ENSP00000337541 |H-INV:HIT000000309; HIT000024122 Tax_Id=9606 Family with sequence similarity 21, member C 15 LLEPSVGSLFGDDEDDDLFSSAK; AVASPEATVSQTDENK; IAENPANPPVGGK; DNDPDVDLFAGTK; ETVSEAPPLLFSDEEEK; HSDLFSSSSPWDK; SPMFPALGEASSDDDLFQSAK; VQSTADIFGDEEGDLFK; GEADLFDSGDIFSTGTGSQSVER; VYDEEVEEPVLK; SHGLESVPVLPGSGEAGVSFDLPAQADTLHSANK; VDEEPTTLPSGEAK; GDAMGRVDEEPTTLPSGEAK; TNPFPLLEDEDDLFTDQK; QTLSLQAQREEK 1 IPI00456853.3
509 S_Total95_4584 IPI00018873.1 |SWISS-PROT:P43490 |REFSEQ_NP:NP_005737 |ENSEMBL:ENSP00000222553 Tax_Id=9606 Pre-B cell enhancing factor precursor 15 EHFQDDVFNEK; STQAPLIIRPDSGNPLDTVLK; VYSYFECR; YEETVFYGLQYILNK; YLLETSGNLDGLEYK; GTDTVAGLALIK; AVPEGFVIPR; GWNYILEK; DAFEHIVTQFSSVPVSVVSDSYDIYNACEK; VIQGDGVDINTLQEIVEGMK; GDLEEYGQDLLHTVFK; MWSIENIAFGSGGGLLQK; TPAGNFVTLEEGK; NAQLNIELEAAHH; TPAGNFVTLEEGKGDLEEYGQDLLHTVFK 1 IPI00018873.1
510 S_Total95_5122 IPI00009329.1 |SWISS-PROT:P46939 |TREMBL:Q6LBS5; Q5JRT2; Q5T097; Q5JRT5; Q5THP1; Q5SZ57; Q5JRT1; Q5JRT0 |REFSEQ_NP:NP_009055 |ENSEMBL:ENSP00000282749 Tax_Id=9606 Utrophin 15 KLLDLLEGLTGTSLPK; LLDLLEGLTGTSLPK; KFDAISAELLNWILK; LEDSSNQVTQAVAK; LQLLLLHTRYNK; STSEGLLGDLDTEISWAK; TDAVNEALESLESVLR; NMKEIETNLRSGPVAGIK; LVSELDDANLQVENVR; QLDELEKVIK; GSSSRELVEPK; DVMSDLQQTNSEK; DLQGAMDDLDADMK; ETDQMLQVLQESLGELDK; LEDSSNQVTQAVAKLGMSQIPQKDLLETVR 1 IPI00009329.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home