Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
511 S_Total95_5262 IPI00004860.2 |SWISS-PROT:P54136 |TREMBL:Q53GY4 |REFSEQ_NP:NP_002878 |ENSEMBL:ENSP00000231572 |H-INV:HIT000036815; HIT000029710 Tax_Id=9606 Arginyl-tRNA synthetase 15 LNDYIFSFDK; LNILRKSLQAER; STIIGESISR; VLTAEELNAAQTSVAYGCIK; AAYPDLENPPLLVTPSQQAK; LQEVFGHAIK; NCGCLGASPNLEQLQEENLK; VIVDFSSPNIAK; AYQCVVLLQGK; SDGGYTYDTSDLAAIK; IVFVPGCSIPLTIVK; LFEFAGYDVLR; FPDYLTVSPPIGDLQVFYK; VEIAGPGFINVHLR; SGETVRLMDLLGEGLK 1 IPI00004860.2
512 S_Total95_5852 IPI00328715.4 |SWISS-PROT:Q86UE4 |TREMBL:Q52QU9 |REFSEQ_NP:NP_848927 |ENSEMBL:ENSP00000338235 |H-INV:HIT000003220 Tax_Id=9606 LYRIC protein 15 TELGLDLGLEPK; EEAAAVPAAAPDDLALLK; QGEDNSTAQDTEELEK; SIFSGIGSTAEPVSQSTTSDYQWDVSR; SSSQVPPILQETDK; TISTSDPAEVLVK; TLPPATSTEPSVILSK; SWQDELAQQAEEGSAR; TVEVAEGEAVR; LSSQISAGEEK; WNSVSPASAGK; GDSTLQVSSGLNENLTVNGGGWNEK; TEPSAWSQDTGDANTNGK; VLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSK; KTEPSAWSQDTGDANTNGK 1 IPI00328715.4
513 S_Total95_24 IPI00010290.1 |SWISS-PROT:P07148 |TREMBL:Q6FGL7 |REFSEQ_NP:NP_001434 |ENSEMBL:ENSP00000295834 |H-INV:HIT000041727 Tax_Id=9606 Fatty acid-binding protein, liver 14 AIGLPEELIQK; GVSEIVQNGK; TVVQLEGDNK; SVTELNGDIITNTMTLGDIVFK; TVVQLEGDNKLVTTFK; VIQNEFTVGEECELETMTGEK; YQLQSQENFEAFMK; VKTVVQLEGDNK; SVTELNGDIITNTMTLGDIVFKR; GVSEIVQNGKHFK; FTITAGSK; DIKGVSEIVQNGK; AIGLPEELIQKGK; Comb; PMF 1 IPI00010290.1
514 S_Total95_44 IPI00295542.4 |SWISS-PROT:Q02818 |TREMBL:Q53GX6; Q96BA4 |REFSEQ_NP:NP_006175 |ENSEMBL:ENSP00000263273 |H-INV:HIT000037324; HIT000030823; HIT000008732 Tax_Id=9606 Nucleobindin 1 precursor 14 LPEVEVPQHL; LVTLEEFLASTQR; FHPDTDDVPVPAPAGDQK; DLELLIQTATR; EVWEELDGLDPNR; VNVPGSQAQLK; ELDFVSHHVR; FEEELAAR; LSQETEALGR; RFEEELAAR; YLESLGEEQR; YLQEVIDVLETDGHFR; MDAEQDPNVQVDHLNLLK; PMF; Comb 1 IPI00295542.4
515 S_Total95_46 IPI00021772.1 |SWISS-PROT:Q00266 |TREMBL:Q5QP09 |REFSEQ_NP:NP_000420 |ENSEMBL:ENSP00000280867 |H-INV:HIT000038336 Tax_Id=9606 S-adenosylmethionine synthetase alpha and beta forms 14 FVIGGPQGDAGVTGR; ELLDVVHK; ICDQISDAVLDAHLK; YLDEDTVYHLQPSGR; SGLLPWLRPDSK; IIVDTYGGWGAHGGGAFSGK; KIIVDTYGGWGAHGGGAFSGK; TACYGHFGR; TGMVLLCGEITSMAMVDYQR; SEFPWEVPR; TCNVLVALEQQSPDIAQCVHLDR; NEEDVGAGDQGLMFGYATDETEECMPLTIILAHK; TQVTVQYMQDNGAVIPVR; PMF; Comb 1 IPI00021772.1
516 S_Total95_49 IPI00219953.2 |SWISS-PROT:P30085 |TREMBL:Q5SVZ0; Q53GB7 |REFSEQ_NP:NP_057392 |ENSEMBL:ENSP00000294340 |H-INV:HIT000008532; HIT000001896; HIT000036924; HIT000001871 Tax_Id=9606 UMP-CMP kinase variant 14 KNPDSQYGELIEK; YGYTHLSAGELLR; IVPVEITISLLK; FLIDGFPR; IVPVEITISLLKR; NPDSQYGELIEK; EMDQTMAANAQKNK; EMDQTMAANAQK; PLVVFVLGGPGAGK; SVDEVFDEVVQIFDK; SVDEVFDEVVQIFDKEG; PIIDLYEEMGK; IQTYLQSTKPIIDLYEEMGK; PMF; Comb 1 IPI00219953.2
517 S_Total95_70 IPI00218414.4 |SWISS-PROT:P00918 |TREMBL:Q6LD99; Q6FI12 |REFSEQ_NP:NP_000058 |ENSEMBL:ENSP00000285379 |H-INV:HIT000035559 Tax_Id=9606 Carbonic anhydrase II 14 AVQQPDGLAVLGIFLK; VVDVLDSIK; EPISVSSEQVLK; YDPSLKPLSVSYDQATSLR; ILNNGHAFNVEFDDSQDK; SADFTNFDPR; GGPLDGTYR; QSPVDIDTHTAK; LNFNGEGEPEELMVDNWR; YAAELHLVHWNTK; GLLPESLDYWTYPGSLTTPPLLECVTWIVLK; LIQFHFHWGSLDGQGSEHTVDK; VVDVLDSIKTK; PMF; Comb 1 IPI00218414.4
518 S_Total95_71 IPI00012011.3 |SWISS-PROT:P23528 |TREMBL:Q53Y87 |REFSEQ_NP:NP_005498 |ENSEMBL:ENSP00000309629 |H-INV:HIT000035736; HIT000022544; HIT000035754; HIT000035160; HIT000038318 Tax_Id=9606 Cofilin-1 14 HELQANCYEEVK; LGGSAVISLEGKPL; YALYDATYETK; AVLFCLSEDKK; EILVGDVGQTVDDPYATFVK; KEDLVFIFWAPESAPLK; AVLFCLSEDK; EDLVFIFWAPESAPLK; HELQANCYEEVKDR; LGGSAVISLEGK; NIILEEGKEILVGDVGQTVDDPYATFVK; KAVLFCLSEDKK; MLPDKDCR; PMF; Comb 1 IPI00012011.3
519 S_Total95_99 IPI00301277.1 |SWISS-PROT:P34931 |TREMBL:Q53FA3 |REFSEQ_NP:NP_005518 Tax_Id=9606 Heat shock 70 kDa protein 1L 14 VEIIANDQGNR; IINEPTAAAIAYGLDK; VEILANDQGNR; TTPSYVAFTDTER; ATAGDTHLGGEDFDNR; DAGVIAGLNVLR; AFYPEEISSMVLTK; AKIHDIVLVGGSTR; SINPDEAVAYGAAVQAAILMGDK; NALESYAFNMK; GVPQIEVTFDIDANGILNVTATDK; CNELLSWLEVNQLAEKDEFDHKR; Comb; QTQIFTTYSDNQPGVLIQVYEGER 1 IPI00301277.1
520 S_Total95_117 IPI00216592.1 |SWISS-PROT:P07910-2 |TREMBL:Q86SF8 |REFSEQ_NP:NP_004491 |ENSEMBL:ENSP00000319690; ENSP00000338095 |H-INV:HIT000033742; HIT000031541 Tax_Id=9606 Splice Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 14 SDVEAIFSK; VFIGNLNTLVVK; KSDVEAIFSK; VFIGNLNTLVVKK; SMNSRVFIGNLNTLVVKK; LKGDDLQAIK; QKVDSLLENLEK; VDSLLENLEK; GFAFVQYVNER; MIAGQVLDINLAAEPK; IVGCSVHKGFAFVQYVNER; MEKEQSKQAVEMK; VPPPPPIAR; Comb; PMF 1 IPI00216592.1
521 S_Total95_125 IPI00451401.2 |SWISS-PROT:P60174-2 Tax_Id=9606 Splice Isoform 2 of Triosephosphate isomerase 14 FFVGGNWK; HVFGESDELIGQK; KQSLGELIGTLNAAK; QSLGELIGTLNAAK; KFFVGGNWK; VAHALAEGLGVIACIGEK; VPADTEVVCAPPTAYIDFAR; VTNGAFTGEISPGMIK; VVLAYEPVWAIGTGK; RHVFGESDELIGQK; IAVAAQNCYK; MNGRKQSLGELIGTLNAAK; DCGATWVVLGHSER; PMF; Comb 1 IPI00451401.2
522 S_Total95_234-1 IPI00005040.1 |SWISS-PROT:P11310 |TREMBL:Q5T4U4 |REFSEQ_NP:NP_000007 |ENSEMBL:ENSP00000235701 |H-INV:HIT000032422 Tax_Id=9606 Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor 14 EEIIPVAAEYDK; ENVLIGDGAGFK; IYQIYEGTSQIQR; TGEYPVPLIR; AAWEVDSGR; AFAGDIANQLATDAVQILGGNGFNTEYPVEK; AFTGFIVEADTPGIQIGR; ANWYFLLAR; TRPVVAAGAVGLAQR; KGDEYIINGQK; EPGLGFSFEFTEQQK; PVVAAGAVGLAQR; QREPGLGFSFEFTEQQK; PMF; Comb 1 IPI00005040.1
523 S_Total95_234-2 IPI00513827.2 |TREMBL:Q5T4U5; Q5HYG7 Tax_Id=9606 Hypothetical protein DKFZp686M24262 14 EEIIPVAAEYDK; ENVLIGDGAGFK; IYQIYEGTSQIQR; TGEYPVPLIR; AAWEVDSGR; AFAGDIANQLATDAVQILGGNGFNTEYPVEK; AFTGFIVEADTPGIQIGR; ANWYFLLAR; TRPVVAAGAVGLAQR; KGDEYIINGQK; EPGLGFSFEFTEQQK; PVVAAGAVGLAQR; QREPGLGFSFEFTEQQK; PMF; Comb 1 IPI00513827.2
524 S_Total95_244 IPI00553177.1 |SWISS-PROT:P01009 |TREMBL:Q5U0M1; Q86U19; Q86U18; Q53XB8; Q9UCE6; Q13747 |REFSEQ_NP:NP_001002235; NP_001002236; NP_000286 |ENSEMBL:ENSP00000347148; ENSP00000348068 |H-INV:HIT000037235; HIT000035588; HIT000009448 Tax_Id=9606 Alpha-1-antitrypsin precursor 14 AVLTIDEK; DTEEEDFHVDQVTTVK; LQHLENELTHDIITK; VFSNGADLSGVTEEAPLK; ELDRDTVFALVNYIFFK; LSITGTYDLK; SVLGQLGITK; TLNQPDSQLQLTTGNGLFLSEGLK; LGMFNIQHCK; TDTSHHDQDHPTFNK; LSSWVLLMK; LYHSEAFTVNFGDTEEAKK; SASLHLPK; PMF; Comb 1 IPI00553177.1
525 S_Total95_278 IPI00293867.6 |SWISS-PROT:P30046 |TREMBL:Q53Y51 |REFSEQ_NP:NP_001346 |ENSEMBL:ENSP00000215773 |H-INV:HIT000037151; HIT000032564 Tax_Id=9606 D-dopachrome tautomerase 14 FFPLESWQIGK; PFLELDTNLPANR; SHSAHFFEFLTK; LCAAAASILGK; FFPLESWQIGKIGTVMTFL; LCAAAASILGKPADR; RLCAAAASILGK; VNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNR; RLCAAAASILGKPADR; PFLELDTNLPANRVPAGLEKR; PGLAMALSGSTEPCAQLSISSIGVVGTAEDNR; PFLELDTNLPANRVPAGLEK; ELALGQDR; PMF; Comb 1 IPI00293867.6
526 S_Total95_312 IPI00027350.1 |SWISS-PROT:P32119 |TREMBL:Q6FHG4 |REFSEQ_NP:NP_005800 |ENSEMBL:ENSP00000301522 |H-INV:HIT000031366; HIT000029637 Tax_Id=9606 Peroxiredoxin 2 14 QITVNDLPVGR; GLFIIDGK; RLSEDYGVLK; ATAVVDGAFK; EGGLGPLNIPLLADVTR; KEGGLGPLNIPLLADVTR; LSEDYGVLK; PGSDTIKPNVDDSK; TDEGIAYR; LVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSK; IGKPAPDFK; KLGCEVLGVSVDSQFTHLAWINTPR; LGCEVLGVSVDSQFTHLAWINTPR; PMF; Comb 1 IPI00027350.1
527 S_Total95_314 IPI00011937.1 |SWISS-PROT:Q13162 |REFSEQ_NP:NP_006397 |ENSEMBL:ENSP00000319964 |H-INV:HIT000037681; HIT000031638; HIT000033054 Tax_Id=9606 Peroxiredoxin 4 14 GLFIIDDK; LVQAFQYTDK; QITLNDLPVGR; IPLLSDLTHQISK; DYGVYLEDSGHTLR; PAPYWEGTAVIDGEFK; PGSETIIPDPAGKLKYFDK; VSVADHSLHLSK; HGEVCPAGWKPGSETIIPDPAGK; ISKPAPYWEGTAVIDGEFK; SINTEVVACSVDSQFTHLAWINTPR; TREEECHFYAGGQVYPGEASR; GLFIIDDKGILR; PMF; Comb 1 IPI00011937.1
528 S_Total95_321 IPI00009375.3 |SWISS-PROT:P46952 |TREMBL:Q53QZ7 |REFSEQ_NP:NP_036337 |ENSEMBL:ENSP00000294973 |H-INV:HIT000040792 Tax_Id=9606 3-hydroxyanthranilate 3,4-dioxygenase 14 DLGTQLAPIIQEFFSSEQYR; ELQAGTPLSLFGDTYETQVIAYGQGSSEGLR; LSLAPDDSLLVLAGTSYAWER; TQGSVALSVTQDPACK; FANTVGLVVER; QGEIFLLPAR; RLETELDGLR; TGKPIPDQLLK; GSFQPPVCNK; LETELDGLR; YYVGDTMDVLFEK; TGKPIPDQLLKEPPFPLSTR; EPPFPLSTR; PMF; Comb 1 IPI00009375.3
529 S_Total95_349 IPI00022314.1 |SWISS-PROT:P04179 Tax_Id=9606 Superoxide dismutase [Mn], mitochondrial precursor 14 GDVTAQIALQPALK; AIWNVINWENVTER; HHAAYVNNLNVTEEK; LTAASVGVQGSGWGWLGFNK; GELLEAIK; HHAAYVNNLNVTEEKYQEALAK; FNGGGHINHSIFWTNLSPNGGGEPK; GHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYK; HSLPDLPYDYGALEPHINAQIMQLHHSK; DFGSFDK; GELLEAIKR; DFGSFDKFK; NVRPDYLK; PMF; Comb 1 IPI00022314.1
530 S_Total95_356 IPI00013847.3 |SWISS-PROT:P31930 |REFSEQ_NP:NP_003356 |ENSEMBL:ENSP00000203407 |H-INV:HIT000034453 Tax_Id=9606 Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial precursor 14 ADLTEYLSTHYK; RIPLAEWESR; AVELLGDIVQNCSLEDSQIEK; DVVFNYLHATAFQGTPLAQAVEGPSENVR; HLGGIPWTYAEDAVPTLTPCR; IAEVDASVVR; IPLAEWESR; LCTSATESEVAR; NALVSHLDGTTPVCEDIGR; NNGAGYFLEHLAFK; YIYDQCPAVAGYGPIEQLPDYNR; MVLAAAGGVEHQQLLDLAQK; ADLTEYLSTHYKAPR; PMF; Comb 1 IPI00013847.3
531 S_Total95_393 IPI00032297.1 |SWISS-PROT:P26440 |TREMBL:Q53XZ9 |REFSEQ_NP:NP_002216 |ENSEMBL:ENSP00000249760 |H-INV:HIT000006051; HIT000037872 Tax_Id=9606 Isovaleryl-CoA dehydrogenase, mitochondrial precursor 14 LYEIGAGTSEVR; FLQEHLAPK; FWITNGPDADVLIVYAK; GSNTCELIFEDCK; TDLAAVPASR; ASGAVGLSYGAHSNLCINQLVR; GITAFIVEK; IPAANILGHENK; GVYVLMSGLDLER; LISGEYIGALAMSEPNAGSDVVSMK; GSNTCELIFEDCKIPAANILGHENK; QLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISR; LVLAGGPLGLMQAVLDHTIPYLHVR; PMF; Comb 1 IPI00032297.1
532 S_Total95_502 IPI00220709.3 |SWISS-PROT:P07951-2 |TREMBL:Q5TCU4; Q5TCU3 |REFSEQ_NP:NP_998839 |ENSEMBL:ENSP00000351239 |H-INV:HIT000035444 Tax_Id=9606 Splice Isoform 2 of Tropomyosin beta chain 14 IQLVEEELDR; EDKYEEEIK; KLVILEGELER; EENVEIHQTLDQTLLELNNL; TIDDLEETLASAK; YEEEIKLLEEK; LEEAEKAADESER; LVILEGELER; QLEEEQQALQK; SLMASEEEYSTK; RIQLVEEELDR; ATDAEADVASLNR; KATDAEADVASLNR; Comb; PMF 1 IPI00220709.3
533 S_Total95_567 IPI00026314.1 |SWISS-PROT:P06396 |TREMBL:Q5T0I2 |REFSEQ_NP:NP_000168 |ENSEMBL:ENSP00000277268 |H-INV:HIT000040076 Tax_Id=9606 Gelsolin precursor 14 AGALNSNDAFVLK; AQPVQVAEGSEPDGFWEALGGK; SEDCFILDHGK; QTQVSVLPEGGETPLFK; PALPAGTEDTAK; TPSAAYLWVGTGASEAEK; VSNGAGTMSVSLVADENPFAQGALK; DPDQTDGLGLSYLSSHIANVER; YIETDPANR; DSQEEEKTEALTSAK; EVQGFESATFLGYFK; VHVSEEGTEPEAMLQVLGPK; HVVPNEVVVQR; Comb; PMF 1 IPI00026314.1
534 S_Total95_590 IPI00010314.2 |SWISS-PROT:P13716 |REFSEQ_NP:NP_000022 |ENSEMBL:ENSP00000277315 |H-INV:HIT000030039 Tax_Id=9606 Delta-aminolevulinic aciD DehyDratase isoform b 14 LAEVALAYAK; CVLIFGVPSR; EALMAHGLGNR; GSAADSEESPAIEAIHLLR; FASCFYGPFR; AAVLEAMTAFR; AGADIIITYYTPQLLQWLK; AGCQVVAPSDMMDGR; CYQLPPGAR; LEEMLRPLVEEGLR; RLEEMLRPLVEEGLR; PGMPYLDIVR; EGADMLMVKPGMPYLDIVR; PMF; Comb 1 IPI00010314.2
535 S_Total95_620 IPI00007247.3 |SWISS-PROT:P05166 |TREMBL:Q96CX0; Q59GV0; Q8WVH4; Q86TD7 |REFSEQ_NP:NP_000523 |ENSEMBL:ENSP00000251654 |H-INV:HIT000036355; HIT000026890 Tax_Id=9606 Propionyl-CoA carboxylase beta chain, mitochondrial precursor 14 IQEGVESLAGYADIFLR; SVTNEDVTQEELGGAK; AFENDVDALCNLR; DTSYLFITGPDVVK; LVPELDTIVPLESTK; VASGCLDINSSVK; AYNMVDIIHSVVDER; GHENVEAAQAEYIEK; ICCDLDVLASK; LLYAFAEATVPK; GFVDDIIQPSSTR; HLCGDTNYAWPTAEIAVMGAK; IMDQAITVGAPVIGLNDSGGAR; PMF; Comb 1 IPI00007247.3
536 S_Total95_664 IPI00219005.2 |SWISS-PROT:Q02790 |REFSEQ_NP:NP_002005 |ENSEMBL:ENSP00000001008 |H-INV:HIT000033535; HIT000030649 Tax_Id=9606 FK506-binding protein 4 14 SNTAGSQSQVETEA; FEIGEGENLDLPYGLER; ATESGAQSAPLPMEGVDISPK; GEAHLAVNDFELAR; TQLAVCQQR; LQAFSAAIESCNK; IPPNATLVFEVELFEFK; LASHLNLAMCHLK; PEYAYGSAGSPPK; GEDLTEEEDGGIIR; VGEVCHITCKPEYAYGSAGSPPK; AEASSGDHPTDTEMKEEQK; GEGYAKPNEGAIVEVALEGYYKDK; Comb; PMF 1 IPI00219005.2
537 S_Total95_671 IPI00215983.2 |SWISS-PROT:P00915 |REFSEQ_NP:NP_001729 |ENSEMBL:ENSP00000256119 |H-INV:HIT000040338 Tax_Id=9606 Carbonic anhydrase I 14 ESISVSSEQLAQFR; ADGLAVIGVLMK; EIINVGHSFHVNFEDNDNR; HDTSLKPISVSYNPATAK; YSAELHVAHWNSAK; LYPIANGNNQSPVDIK; VLDALQAIK; YSSLAEAASK; VLDALQAIKTKGK; PISVSYNPATAK; TSETKHDTSLKPISVSYNPATAK; SLLSNVEGDNAVPMQHNNRPTQPLK; GGPFSDSYR; PMF; Comb 1 IPI00215983.2
538 S_Total95_745 IPI00013925.3 |SWISS-PROT:P07902 |TREMBL:Q53XK1; Q5VZ81; P78433 |REFSEQ_NP:NP_000146 |ENSEMBL:ENSP00000319899 |H-INV:HIT000036980 Tax_Id=9606 Galactose-1-phosphate uridylyltransferase 14 QQASEADAAAATFR; RPWQGQVEPQLLK; HDPLNPLCPGAIR; PWQGQVEPQLLK; YNPLQDEWVLVSAHR; GAMMGCSNPHPHCQVWASSFLPDIAQR; AVVDAWASVTEELGAQYPWVQIFENK; FMVGYEMLAQAQR; VMCFHPWSDVTLPLMSVPEIR; ALPEVHYHLGQK; DLTPEQAAER; ANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAK; ALPEVHYHLGQKDR; Comb; PMF 1 IPI00013925.3
539 S_Total95_775 IPI00015018.1 |SWISS-PROT:Q15181 |TREMBL:Q5SQT7; Q5SQT6 |REFSEQ_NP:NP_066952 |ENSEMBL:ENSP00000317687 |H-INV:HIT000014799; HIT000001930 Tax_Id=9606 Inorganic pyrophosphatase 14 YVANIFPYK; AAPFSLEYR; GYIWNYGAIPQTWEDPGHNDK; VIAINVDDPDAANYNDINDVK; AIVDALPPPCESACTVPTDVDK; DKDFAIDIIK; GQYISPFHDIPIYADK; GISCMNTTLSESPFK; HTGCCGDNDPIDVCEIGSK; VLGILAMIDEGETDWK; LKPGYLEATVDWFR; VPDGKPENEFAFNAEFK; YKVPDGKPENEFAFNAEFK; PMF; Comb 1 IPI00015018.1
540 S_Total95_805 IPI00554615.1 |TREMBL:Q5EFE5 Tax_Id=9606 Anti-RhD monoclonal T125 gamma1 heavy chain precursor 14 NQVSLTCLVK; EPQVYTLPPSR; STSGGTAALGCLVK; VVSVLTVLHQDWLNGK; GPSVFPLAPSSK; FNWYVDGVEVHNAK; TPEVTCVVVDVSHEDPEVK; THTCPPCPAPELLGGPSVFLFPPKPK; THTCPPCPAPELLGGPSVFLFPPK; EPQVYTLPPSRDELTK; GFYPSDIAVEWESNGQPENNYK; TTPPVLDSDGSFFLYSK; GVQCQVQLVESGGGVVQPGRSLR; PMF; Comb 1 IPI00554615.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home