Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
541 S_Total95_911 IPI00418262.3 |SWISS-PROT:P09972 |TREMBL:Q6FH94; Q6P0L5 |REFSEQ_NP:NP_005156 |ENSEMBL:ENSP00000226253 Tax_Id=9606 Fructose-bisphosphate aldolase C 14 PWALTFSYGR; YASICQQNGIVPIVEPEILPDGDHDLKR; YASICQQNGIVPIVEPEILPDGDHDLK; DNAGAATEEFIK; ALQASALNAWR; GVVPLAGTDGETTTQGLDGLSER; LSQIGVENTEENR; TPSALAILENANVLAR; YEGSGEDGGAAAQSLYIANHAY; AEVNGLAAQGK; QVLFSADDR; YTPEEIAMATVTALR; GILAADESVGSMAK; PMF; Comb 1 IPI00418262.3
542 S_Total95_932-1 IPI00479946.2 |ENSEMBL:ENSP00000351646 Tax_Id=9606 68 kDa protein 14 LAYINPDLALEEK; ALSVGNIDDALQCYSEAIK; DCEECIQLEPTFIK; CQQAEKILKEQER; DPQALSEHLK; AAALEFLNR; ELDPTNMTYITNQAAVYFEK; ETKPEPMEEDLPENK; KETKPEPMEEDLPENK; LMDVGLIAIR; AMADPEVQQIMSDPAMR; TYEEGLKHEANNPQLK; AAALEFLNRFEEAKR; PMF; Comb 1 IPI00479946.2
543 S_Total95_932-2 IPI00013894.1 |SWISS-PROT:P31948 |TREMBL:Q5TZU9 |REFSEQ_NP:NP_006810 |ENSEMBL:ENSP00000305958 |H-INV:HIT000031338 Tax_Id=9606 Stress-induced-phosphoprotein 1 14 LAYINPDLALEEK; ALSVGNIDDALQCYSEAIK; DCEECIQLEPTFIK; CQQAEKILKEQER; DPQALSEHLK; AAALEFLNR; ELDPTNMTYITNQAAVYFEK; ETKPEPMEEDLPENK; KETKPEPMEEDLPENK; LMDVGLIAIR; AMADPEVQQIMSDPAMR; TYEEGLKHEANNPQLK; AAALEFLNRFEEAKR; PMF; Comb 1 IPI00013894.1
544 S_Total95_1069 IPI00218918.4 |SWISS-PROT:P04083 |TREMBL:Q5T3N0; Q5TZZ9 |REFSEQ_NP:NP_000691 |ENSEMBL:ENSP00000257497 |H-INV:HIT000015260 Tax_Id=9606 Annexin A1 14 GVDEATIIDILTK; ALTGHLEEVVLALLK; GLGTDEDTLIEILASR; TPAQFDADELR; DITSDTSGDFR; QAWFIENEEQEYVQTVK; AAYLQETGKPLDETLK; GGPGSAVSPYPTFNPSSDVAALHK; SEDFGVNEDLADSDAR; GTDVNVFNTILTTR; KGTDVNVFNTILTTR; RKGTDVNVFNTILTTR; MYGISLCQAILDETK; Comb; PMF 1 IPI00218918.4
545 S_Total95_1093 IPI00219077.1 |SWISS-PROT:P09960-1 |TREMBL:Q6IAT6; Q59ES1 |REFSEQ_NP:NP_000886 |ENSEMBL:ENSP00000228740 |H-INV:HIT000041586 Tax_Id=9606 LTA4H protein 14 EDDLNSFNATDLK; DLSSHQLNEFLAQTLQR; LVVDLTDIDPDVAYSSVPYEK; TLTGTAALTVQSQEDNLR; HFNALGGWGELQNSVK; SSALQWLTPEQTSGK; DGETPDPEDPSR; LTYTAEVSVPK; GSPMEISLPIALSK; SAYEFSETESMLK; SLSNVIAHEISHSWTGNLVTNK; AILPCQDTPSVK; WEDAIPLALK; Comb; PMF 1 IPI00219077.1
546 S_Total95_1207 IPI00028520.2 |SWISS-PROT:P49821-1 |TREMBL:Q6IBR3; Q53G70 |REFSEQ_NP:NP_009034 |ENSEMBL:ENSP00000322450 |H-INV:HIT000001839; HIT000037237 Tax_Id=9606 Splice Isoform 1 of NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial precursor 14 EAYEAGLIGK; YLVVNADEGEPGTCK; GAGAYICGEETALIESIEGK; GEFYNEASNLQVAIR; IFTNLYGR; TSFGSLKDEDR; PAEIDSLWEISK; LFNISGHVNHPCTVEEEMSVPLK; GGTWFAGFGR; SVCETVLMDFDALVQAQTGLGTAAVIVMDR; LKPPFPADVGVFGCPTTVANVETVAVSPTICR; HAGGVTGGWDNLLAVIPGGSSTPLIPK; HFRPELEER; Comb; PMF 2 IPI00221298.1, IPI00028520.2
547 S_Total95_1250 IPI00220628.1 |SWISS-PROT:Q99996-6 |ENSEMBL:ENSP00000339128 |H-INV:HIT000008434 Tax_Id=9606 Splice Isoform 6 of A-kinase anchor protein 9 14 MEQETQRKLEQLR; QSSEEIKQLMGTVEELQKR; VYEMEQDKKVENSNK; FAQLEAENSILK; TQETGDEGKPLHLLIGK; EIEILIEENEDLK; EKLKEELGLILEEK; FCQDNQTISSEPER; TELTALGTTDAVGLLNCLEQR; ELEAFRLEVK; FSLNGGANIEAIIASEKEVWNR; ERESVEKIQSIPENSVNVAIDHLSK; FSLNGGANIEAIIASEKEVWNREK; PMF 1 IPI00220628.1
548 S_Total95_1265 IPI00397571.1 |SWISS-PROT:Q9UNZ2-5 |TREMBL:Q5JXA5 Tax_Id=9606 Splice Isoform 3 of NSFL1 cofactor p47 14 LGAAPEEESAYVAGEK; LGSTAPQVLSTSSPAQQAENEAK; RGEVPAELR; SYQDPSNAQFLESIR; EFVAVTGAEEDR; EANLLNAVIVQR; GAKEHGAVAVERVTK; KSPNELVDDLFK; SPNELVDDLFK; PAMAATSFILMTTFPNKELADESQTLK; LAHGGQVNLDMEDHR; DLIHDQDEDEEEEEGQR; ASSSILIDESEPTTNIQIR; PMF; Comb 2 IPI00100197.3, IPI00397571.1
549 S_Total95_1308 IPI00017184.2 |SWISS-PROT:Q9H4M9 |REFSEQ_NP:NP_006786 |ENSEMBL:ENSP00000352354; ENSP00000320516 |H-INV:HIT000022696 Tax_Id=9606 EH-domain containing protein 1 14 LDISDEFSEVIK; LNAFGNAFLNR; KLNAFGNAFLNR; VYIGSFWSHPLLIPDNRK; LNDLIKR; GYDFAAVLEWFAER; VYIGSFWSHPLLIPDNR; EHQISPGDFPSLR; SKLPNTVLGK; KEPELFQTVAEGLR; LLDTVDDMLANDIAR; HLIEQDFPGMR; GGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGK; Comb 1 IPI00017184.2
550 S_Total95_1411 IPI00016457.4 |SWISS-PROT:P43155-1 |TREMBL:Q5T952 |REFSEQ_NP:NP_000746 |ENSEMBL:ENSP00000315013 Tax_Id=9606 Splice Isoform 1 of Carnitine O-acetyltransferase 14 ALQPIVSEEEWAHTK; IYGQACATYESASLR; QDFVDLQGQLR; QLVDEFQASGGVGER; VMIDNETLPVEYLGGK; QPVVIYSSPGVMLPK; IWNSSLQTNK; LPVPPLQQSLDHYLK; LIEGVLDFK; TENWLSEWWLK; KTENWLSEWWLK; SHVAGQMLHGGGSR; IWNSSLQTNKEPVGILTSNHR; Comb 2 IPI00514595.2, IPI00016457.4
551 S_Total95_1542 IPI00007682.2 |SWISS-PROT:P38606 |TREMBL:Q53YD9 |REFSEQ_NP:NP_001681 |ENSEMBL:ENSP00000273398 |H-INV:HIT000036145; HIT000001910 Tax_Id=9606 Vacuolar ATP synthase catalytic subunit A, ubiquitous isoform 14 EILQEEEDLAEIVQLVGK; SDYAQLLEDMQNAFR; TVGMLSNMIAFYDMAR; VLDALFPCVQGGTTAIPGAFGCGK; HFPSVNWLISYSKYMR; LAEMPADSGYPAYLGAR; LPANHPLLTGQR; FTMVQVWPVR; PLSVELGPGIMGAIFDGIQR; TALVANTSNMPVAAR; VGSHITGGDIYGIVSENSLIK; TGKPLSVELGPGIMGAIFDGIQR; VGHSELVGEIIR; PMF; Comb 1 IPI00007682.2
552 S_Total95_1628 IPI00307829.4 |TREMBL:Q96MN6; Q9C0B4; Q6P5Q2; Q96JV2; Q52LR0; Q695C7; Q7Z2L3 |REFSEQ_NP:NP_116255 |ENSEMBL:ENSP00000281282 |H-INV:HIT000001465; HIT000013287; HIT000011135 Tax_Id=9606 Cingulin-like 1 14 DGSVKPSHLLNFQR; TSTLELQNQLDEYKEK; DIDTGSIPGVDQLIEK; GQQELTQQTNEETAK; AAGSAQGNNQACNSTSEVK; SNTSEQDQAGTEMR; LEESEGELR; EQYDAELQALR; SGVTAIRLCSSVVIEDPK; VLETEGSQESTVIR; ALENELEAAQGNLSQTTQEQK; DLQDQLSEMHDELDSAK; GALKEEVSSHDQEMDK; Comb; PMF 1 IPI00307829.4
553 S_Total95_1715 IPI00398435.2 |SWISS-PROT:O15031 |TREMBL:Q7Z2L0 |REFSEQ_XP:XP_371474 |ENSEMBL:ENSP00000352288 |H-INV:HIT000032013; HIT000008975; HIT000000021; HIT000013157; HIT000008689 Tax_Id=9606 PREDICTED: plexin B2 14 VGVSQQPEDSQQDLPGER; SSGGPGAGLCLFPLDK; YYDEIINALEEDPAAQK; DGATLILSK; FGAQLQCVTGPQATR; LQLEQQVATGPALDNK; DLVLSGDLGSLYAMTQDK; DSRSSGGPGAGLCLFPLDKVHAK; SPPNVQFTFQQPK; GTLQQFVDNFFQSVLAPGHAVPPAVK; YTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVK; SFVASNDEGVATVGLVSSTGPGGDR; KAECPRAEEASHWLWSR; Comb 1 IPI00398435.2
554 S_Total95_2437 IPI00551005.1 |H-INV:HIT000014643 Tax_Id=9606 Ig lambda chain C regions 14 STSGGTAALGCLVK; GPSVFPLAPSSK; AAPSVTLFPPSSEELQANK; FNWYVDGVEVHNAK; SYSCQVTHEGSTVEK; TPEVTCVVVDVSHEDPEVK; YAASSYLSLTPEQWK; ATLVCLISDFYPGAVTVAWK; THTCPPCPAPELLGGPSVFLFPPKPK; AGVETTTPSK; TLGRISAKGTAR; ITIAIDTSKR; LTVLSQPK; THTCPPCPAPELLGGPSVFLFPPK 1 IPI00551005.1
555 S_Total95_2439 IPI00550462.1 |H-INV:HIT000021865 Tax_Id=9606 Ig gamma-1 chain C region 14 NQVSLTCLVK; EPQVYTLPPSR; STSGGTAALGCLVK; VVSVLTVLHQDWLNGK; GPSVFPLAPSSK; FNWYVDGVEVHNAK; TPEVTCVVVDVSHEDPEVK; THTCPPCPAPELLGGPSVFLFPPKPK; THTCPPCPAPELLGGPSVFLFPPK; EPQVYTLPPSRDELTK; GFYPSDIAVEWESNGQPENNYK; TTPPVLDSDGSFFLYSK; TEQRELTMEFGLSWLFLVAILK; GNQPRVDIVASIENWGQGTLVTVSSASTK 1 IPI00550462.1
556 S_Total95_2440 IPI00448925.3 |TREMBL:Q6PJ95 |H-INV:HIT000038523 Tax_Id=9606 Hypothetical protein 14 NQVSLTCLVK; EPQVYTLPPSR; STSGGTAALGCLVK; VVSVLTVLHQDWLNGK; GPSVFPLAPSSK; FNWYVDGVEVHNAK; TPEVTCVVVDVSHEDPEVK; THTCPPCPAPELLGGPSVFLFPPKPK; THTCPPCPAPELLGGPSVFLFPPK; VEDTAVYYCAK; EPQVYTLPPSRDELTK; GFYPSDIAVEWESNGQPENNYK; TTPPVLDSDGSFFLYSK; GTLVTVSSASTK 1 IPI00448925.3
557 S_Total95_2441 IPI00426007.1 |TREMBL:Q6MZQ6 Tax_Id=9606 Hypothetical protein DKFZp686G11190 14 NQVSLTCLVK; EPQVYTLPPSR; STSGGTAALGCLVK; VVSVLTVLHQDWLNGK; GPSVFPLAPSSK; FNWYVDGVEVHNAK; TPEVTCVVVDVSHEDPEVK; THTCPPCPAPELLGGPSVFLFPPKPK; THTCPPCPAPELLGGPSVFLFPPK; EPQVYTLPPSRDELTK; GFYPSDIAVEWESNGQPENNYK; TTPPVLDSDGSFFLYSK; LSCAASGFTFR; ADDTAVYYCAR 1 IPI00426007.1
558 S_Total95_2442 IPI00384938.1 |TREMBL:Q7Z351 Tax_Id=9606 Hypothetical protein DKFZp686N02209 14 NQVSLTCLVK; EPQVYTLPPSR; STSGGTAALGCLVK; VVSVLTVLHQDWLNGK; GPSVFPLAPSSK; FNWYVDGVEVHNAK; TPEVTCVVVDVSHEDPEVK; THTCPPCPAPELLGGPSVFLFPPKPK; THTCPPCPAPELLGGPSVFLFPPK; EPQVYTLPPSRDELTK; GFYPSDIAVEWESNGQPENNYK; TTPPVLDSDGSFFLYSK; GTTVIVSSASTK; GTTVIVSSASTKGPSVFPLAPSSK 1 IPI00384938.1
559 S_Total95_2489 IPI00008905.1 |SWISS-PROT:P54855 |TREMBL:Q9UHH3 |REFSEQ_NP:NP_001067 |ENSEMBL:ENSP00000311792 Tax_Id=9606 UDP-glucuronosyltransferase 2B15 precursor 14 WDQFYSEVLGR; WIPQNDLLGHPK; AVFWIEFVMR; KWDQFYSEVLGR; TYWDFEFPR; SVINDPVYK; TILEELVQR; LEVYPTSLTK; FSVGYTFEK; GAALSVDIR; IHHDQPMKPLDR; PFLPNVDFVGGLHCK; TYWDFEFPRPFLPNVDFVGGLHCK; NDLEDSLLK 1 IPI00008905.1
560 S_Total95_2491 IPI00411335.2 |ENSEMBL:ENSP00000341045 Tax_Id=9606 61 kDa protein 14 WDQFYSEVLGR; WIPQNDLLGHPK; AVFWIEFVMR; KWDQFYSEVLGR; TYWDFEFPR; NYLEDSLLK; SVINDPVYK; TILEELVQR; LEVYPTSLTK; FSVGYTFEK; GAALSVDIR; IHHDQPMKPLDR; PFLPNVDFVGGLHCK; TYWDFEFPRPFLPNVDFVGGLHCK 1 IPI00411335.2
561 S_Total95_2616 IPI00003519.1 |SWISS-PROT:Q15029 |TREMBL:Q6IBM8; Q8IXJ3 |REFSEQ_NP:NP_004238 |ENSEMBL:ENSP00000262414 |H-INV:HIT000042172; HIT000030827 Tax_Id=9606 116 kDa U5 small nuclear ribonucleoprotein component 14 GGGQIIPTAR; AFIPAIDSFGFETDLR; STPVTVVLPDTK; TLDELGIHLTK; DSIVQGFQWGTR; SIVIRPLEPQPAPHLAR; VADPVVTFCETVVETSSLK; FFDDPMLLELAK; IAVEPVNPSELPK; YDWDLLAAR; VPAGNWVLIEGVDQPIVK; FFGEFTGFVDMCVQHIPSPKVGAKPK; VEESGEHVILGTGELYLDCVMHDLR; YYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVK 1 IPI00003519.1
562 S_Total95_2622 IPI00478070.2 |ENSEMBL:ENSP00000347534 Tax_Id=9606 43 kDa protein 14 EVTEEDLNNHFK; ENIASVLENYHTESK; GCTGVITLNRPK; LAMLEEDLLALK; TLQEVLTMEYR; WEQDPETFLIIIK; AGIATHFVDSEK; HTDAAEEVLLEK; AVLIDKDQSPK; SLGSSDLKF; KGCTGVITLNRPK; MSPTSLKITLRQLMEGSSK; SFILEEHMDK; INSCFSANTVEEIIENLQQDGSSFALEQLK 1 IPI00478070.2
563 S_Total95_2634 IPI00164895.1 |TREMBL:Q9H241 |ENSEMBL:ENSP00000292414 Tax_Id=9606 Cytochrome P450 variant 3A7 14 FGGLLLTEK; ECYSVFTNR; ETQIPLK; NKDNIDPYIYTPFGSGPR; DNIDPYIYTPFGSGPR; EMVPIIAQYGDVLVR; FGGLLLTEKPIVLK; SLLSPTFTSGK; NAISIAEDEEWKR; VDFLQLMIDSQNSK; VQKEIDTVLPNK; DVEINGMFIPK; RPFGPVGFMK; VLQNFSFKPCK 2 IPI00396632.1, IPI00164895.1
564 S_Total95_2717 IPI00294193.3 |SWISS-PROT:Q14624-1 |TREMBL:Q68DH2 |REFSEQ_NP:NP_002209 |ENSEMBL:ENSP00000266041 Tax_Id=9606 Splice Isoform 1 of Inter-alpha-trypsin inhibitor heavy chain H4 precursor 14 NVVFVIDK; LGVYELLLK; MNFRPGVLSSR; AEAQAQYSAAVAK; LALDNGGLAR; GPDVLTATVSGK; KIQQTREALIK; ITFELVYEELLK; ANTVQEATFQMELPK; NPLVWVHASPEHVVVTR; WKETLFSVMPGLK; TGLLLLSDPDK; QGPVNLLSDPEQGVEVTGQYER; NGIDIYSLTVDSR 2 IPI00218192.1, IPI00294193.3
565 S_Total95_2736 IPI00307246.4 |SWISS-PROT:P05177 |TREMBL:Q6NWU5; Q9UK49; Q9BXX7; Q6NWU3 |REFSEQ_NP:NP_000752 |ENSEMBL:ENSP00000342007 Tax_Id=9606 Cytochrome P450, family 1, subfamily A, polypeptide 2 14 TVQEHYQDFDK; DITGALFK; DTTLNGFYIPK; FLTADGTAINKPLSEK; IGSTPVLVLSR; NTHEFVETASSGNPLDFFPILR; TVQEHYQDFDKNSVR; YGDVLQIR; LAQNALNTFSIASDPASSSSCYLEEHVSK; VDLTPIYGLTMK; LSDRPQLPYLEAFILETFR; SPPEPWGWPLLGHVLTLGK; FLWFLQK; GRPDLYTSTLITDGQSLTFSTDSGPVWAAR 1 IPI00307246.4
566 S_Total95_2781 IPI00328343.7 |SWISS-PROT:Q13838 |TREMBL:Q5RJ61; Q5HYT9; Q59G92; Q5HYT6; Q5STU3; Q5STU1; Q5HYU0; Q53GL9; Q5STA2; Q5HYT8; Q5STA0; Q7KYK3 |REFSEQ_NP:NP_004631; NP_542165 |ENSEMBL:ENSP00000266122 |H-INV:HIT000031879; HIT000036076; HIT000029552 Tax_Id=9606 Spliceosome RNA helicase BAT1 14 DVQEIFR; DFLLKPELLR; ILVATNLFGR; GLAITFVSDENDAK; LTLHGLQQYYVK; MLEQLDMR; MLEQLDMRRDVQEIFR; AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK; CIALAQLLVEQNFPAIAIHR; FEVNISELPDEIDISSYIEQTR; VNIAFNYDMPEDSDTYLHR; GSYVSIHSSGFR; NCPHIVVGTPGR; FMQDPMEIFVDDETK 1 IPI00328343.7
567 S_Total95_2929 IPI00298792.2 |ENSEMBL:ENSP00000221307 Tax_Id=9606 60 kDa protein 14 TLPSQGVDDFLQAK; LVHDFTDAVIQER; TLDFIDVLLLSK; TLDFIDVLLLSKDEDGK; VVLGLTLLR; AEGGLWLR; IFNESVNIMHAK; NWFLGHLGLVTPTEQGMR; CCTQDIVLPDGR; MLTPAFHFNILK; SVINASAAIVPK; VLTQLVATYPQGFK; VWMGPIFPVIR; GIICLISVFGTHHNPAVWPDPEVYDPFR 1 IPI00298792.2
568 S_Total95_3021 IPI00553102.1 |REFSEQ_NP:NP_001011513 |H-INV:HIT000027069; HIT000010491 Tax_Id=9606 PDZ and LIM domain 5 isoform b 14 KILGEVINALK; ANNSQEPSPQLASSVASTR; GALYCELCYEK; GPFLVALGK; KANNSQEPSPQLASSVASTR; YTEFYHVPTHSDASK; ILAQITGTEHLK; PGVTSLTTAAAFK; ISNSATYSGSVAPANSALGQTQPSDQDTLVQR; PGVTSLTTAAAFKPVGSTGVIK; DFNMPLTISSLK; ASAAPKPEPVPVQK; GCTGSLNMTLQR; IGDVVLSIDGINAQGMTHLEAQNK 1 IPI00553102.1
569 S_Total95_3320 IPI00465148.1 |TREMBL:Q6AZE3 Tax_Id=9606 CAST protein 14 GTVPDDAVEALADSLGK; SESELIDELSEDFDR; AAAPAPVSEAVCR; DTSQSDKDLDDALDK; SESELIDELSEDFDRSECK; CGEDDETIPSEYR; DTMSDQALEALSASLGTR; LAAAISEVVSQTPASTTQAGAPPR; TKPQDMISAGGESVAGITAISGK; HLLDDNGQDKPVKPPTK; TSMCSIQSAPPEPATLK; KPADDQDPIDALSGDLDSCPSTTETSQNTAK; ESKEQLPPILSEDFSGPQNASSLKFEDAK; SLTPAVPVESKPDKPSGK 1 IPI00465148.1
570 S_Total95_3428 IPI00445429.1 |TREMBL:Q6ZU90 Tax_Id=9606 Hypothetical protein FLJ43909 14 MADAIILAIAGGQELLARTQKK; NPAVLSAASFDGR; SDQLQQAVQSQGFINYCQK; TTFEDLIQR; AQDGSHPLSLQDLIEK; EQTLSPTITSGLHNIAR; IDASQTEFEK; RPVGASFSFGGK; GRPGPVAGHHQMPR; KPIPDEHLILK; LENEGDSLLQTQACLCYICAGNVEK; LSSSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLK; PNIEGAPGAPIGNTFQHVQSLPTK; MVKLVLLSIVLLKVTVPK 1 IPI00445429.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home