Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
31 S_Total95_399 IPI00164623.3 |SWISS-PROT:P01024 |TREMBL:Q6LDJ0 |REFSEQ_NP:NP_000055 |ENSEMBL:ENSP00000245907 |H-INV:HIT000019583 Tax_Id=9606 Complement C3 precursor 49 DSCVGSLVVK; TIYTPGSTVLYR; EPGQDLVVLPLSITTDFIPSFR; QLYNVEATSYALLALLQLK; SNLDEDIIAEENIVSR; VPVAVQGEDTVQSLTQGDGVAK; DYAGVFSDAGLTFTSSSGQQTAQR; IHWESASLLR; KVEGTAFVIFGIQDGEQR; LSINTHPSQKPLSITVR; SGIPIVTSPYQIHFTK; VELLHNPAFCSLATTK; VFLDCCNYITELR; VYAYYNLEESCTR; AGDFLEANYMNLQR; AYYENSPQQVFSTEFEVK; DTWVEHWPEEDECQDEENQK; EDIPPADLSDQVPDTESETR; GYTQQLAFR; ILLQGTPVAQMTEDAVDAER; IPIEDGSGEVVLSR; LVAYYTLIGASGQR; SEETKENEGFTVTAEGK; SSLSVPYVIVPLK; VHQYFNVELIQPGAVK; VQLSNDFDEYIMAIEQTIK; ACEPGVDYVYK; AELQCPQPAAR; CAEENCFIQK; DICEEQVNSLPGSITK; KGYTQQLAFR; SGSDEVQVGQQR; VSHSEDDCLAFK; ENEGFTVTAEGK; DFDFVPPVVR; EYVLPSFEVIVEPTEK; TGLQEVEVK; SEFPESWLWNVEDLK; TVMVNIENPEGIPVK; FVTVQATFGTQVVEK; QCQDLGAFTESMVVFGCPN; GDQDATMSILDISMMTGFAPDTDDLK; EGVQKEDIPPADLSDQVPDTESETR; RIPIEDGSGEVVLSR; TELRPGETLNVNFLLR; QDSLSSQNQLGVLPLSWDIPELVNMGQWK; AAVYHHFISDGVR; HYLMWGLSSDFWGEKPNLSYIIGK; Comb; PMF 1 IPI00164623.3
32 S_Total95_787 IPI00215743.2 |SWISS-PROT:Q9P2E9-1 |TREMBL:Q5W165 |ENSEMBL:ENSP00000246043 Tax_Id=9606 Splice Isoform 3 of Ribosome-binding protein 1 49 DALNQATSQVESK; ELESQVSGLEK; LLATEQEDAAVAK; SIEALLEAGQAR; NTDVAQSPEAPK; SVEEEEQVWR; LIEILSEK; LKELESQVSGLEK; TAGPLESSETEEASQLK; TQLEWTEAILEDEQTQR; VEPAVSSVVNSIQVLTSK; LKGELESSDQVR; DAQDVQASQAEADQQQTR; ETSYEEALANQR; HPPAPAEPSSDLASK; LREAEETQSTLQAECDQYR; NTDVAQSPEAPKQEAPAK; SHVEDGDIAGAPASSPEAPPAEQDPVQLK; SKCEELSGLHGQLQEAR; TLQEQLENGPNTQLAR; EAEETQSTLQAECDQYR; LTAEFEEAQTSACR; QLLLESQSQLDAAK; TLVSTVGSMVFNEGEAQR; LQQENSILR; AMEALATAEQACK; VGAAEEELQK; EQEITAVQAR; SILAETEGMLR; EHTSHLEAELEK; AGIIQDTWHK; AQEQQQQMAELHSK; CEELSGLHGQLQEAR; GELESSDQVR; HMAAASAECQNYAK; IPDHDPAPNVTVLLR; AENSQLTER; APAVAVAPTPVQPPIIVAPVATVPAMPQEK; LTAEFEEAQTSACRLQEELEK; TEGAQGKKAER; AEGTQNQSKKAEGAPNQGR; ADSVANQGTKVEGITNQGK; EVPMVVVPPVGAK; ADSVANQGTKVEGITNQGKK; GEPGPPDADGPLYLPYK; KGEPGPPDADGPLYLPYK; TAGPLESSETEEASQLKAGR; KKGEPGPPDADGPLYLPYK; Comb; PMF 1 IPI00215743.2
33 S_Total95_230 IPI00218342.9 |SWISS-PROT:P11586 |REFSEQ_NP:NP_005947 |ENSEMBL:ENSP00000216605 |H-INV:HIT000034591 Tax_Id=9606 C-1-tetrahydrofolate synthase, cytoplasmic 48 DDSNLYINVK; DVDGLTSINAGR; GALALAQAVQR; GVPTGFILPIR; IFHELTQTDK; KVVGDVAYDEAK; TDTESELDLISR; TPVPSDIDISR; VVGDVAYDEAK; LAILQVGNR; MFGIPVVVAVNAFK; AAEEIGIK; TDPTTLTDEEINR; AYIQENLELVEK; YVVVTGITPTPLGEGK; LDIDPETITWQR; AAQAPSSFQLLYDLK; EIGLLSEEVELYGETK; GEWIKPGAIVIDCGINYVPDDK; IYGADDIELLPEAQHK; STTTIGLVQALGAHLYQNVFACVR; VLLSALER; YSGLCPHVVVLVATVR; GDLNDCFIPCTPK; GEPVSAEDLGVSGALTVLMK; KITIGQAPTEKGHTR; LAILQVGNRDDSNLYINVK; DDSNLYINVKLKAAEEIGIK; FSDIQIR; RFSDIQIR; WMIQYNNLNLK; ITIGQAPTEK; QGFGNLPICMAK; GCLELIK; GDILVVATGQPEMVK; LVGPEGFVVTEAGFGADIGMEK; MHGGGPTVTAGLPLPK; THLSLSHNPEQK; KITIGQAPTEK; KGEPVSAEDLGVSGALTVLMK; PGAIVIDCGINYVPDDK; TAHLDEEVNKGDILVVATGQPEMVK; ASVGAGFLYPLVGTMSTMPGLPTR; YITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEK; IVGAPMHDLLLWNNATVTTCHSK; SKIVGAPMHDLLLWNNATVTTCHSK; EQVPGFTPR; Comb; PMF 1 IPI00218342.9
34 S_Total95_606 IPI00029715.3 |SWISS-PROT:Q06278 |TREMBL:Q53RR8; Q53TV3; Q9BYF0 |REFSEQ_NP:NP_001150 |ENSEMBL:ENSP00000260930 Tax_Id=9606 Aldehyde oxidase 48 DILADVVQK; LILNEVSLLGSAPGGK; TGIIAAVTAFAANK; YIQDIVASTLK; HLGTLAGSQIR; LEYGNVDEAFK; QIPLNEQFLSK; EIDQTPYK; TNLPSNTAFR; VFFGEGDGIIR; DEPGSYVPWNVPI; GLHGPLTLNSPLTPEK; GTSTETVPNANISGGSVVADLNGLAVK; HPDSDLNPILAVGNCTLNLLSK; KLEYGNVDEAFK; NHPEPTLDQLTDALGGNLCR; NMASLGGHIISR; QENALAIVNSGMR; VFCVGQLVCAVLADSEVQAK; DWAQTAFDESINLSAVGYFR; KWEFVSAFR; FYLEVSQILK; GLGESGVFLGCSVFFAIHDAVSAAR; ASELLFYVNGR; DILADVVQKLPEEK; EIDQTPYKQEINAK; ELCISYGGVGPATICAK; ENGVCCLDQGINGLPEFEEGSK; GEDQEMDVYVSTQFPK; NVDPETMLLPYLR; RQIPLNEQFLSK; WEFVSAFR; MMWFSPVTLK; YESALEDLHSK; YPQAPVIMGNTSVGPEVK; GEDMLITGGR; MPMSNVHLR; MDPVHYPSLADK; TQMYHALLK; GYESDMNWEK; HWNEQMLDIACR; QERGLHGPLTLNSPLTPEK; FKYPQAPVIMGNTSVGPEVK; IPAICDMPTELHIALLPPSQNSNTLYSSK; IVYQDLEPLILTIEESIQHNSSFKPER; HHPANACLIPICSLYGAAVTTVEGIGSTHTR; FNAENYWK; Comb 1 IPI00029715.3
35 S_Total95_2780 IPI00022418.1 |SWISS-PROT:P02751-1 |TREMBL:Q6N0A6 |ENSEMBL:ENSP00000352696 Tax_Id=9606 Splice Isoform 1 of Fibronectin precursor 48 DLQFVEVTDVK; SYTITGLQPGTDYK; NLQPASEYTVSLVAIK; NTFAEVTGLSPGVTYYFK; VPGTSTSATLTGLTR; TYLGNALVCTCYGGSR; DTLTSRPAQGVVTTLENVSPPR; EYLGAICSCTCFGGQR; FLATTPNSLLVSWQPPR; GDSPASSKPISINYR; GFNCESKPEAEETCFDK; GNLLQCICTGNGR; HTSVQTTSSGSGPFTDVR; HYQINQQWER; IYLYTLNDNAR; LLCQCLGFGSGHFR; SSPVVIDASTAIDAPSNLR; GATYNIIVEALK; PAQGVVTTLENVSPPR; TETITGFQVDAVPANGQTPIQR; WCGTTQNYDADQK; TFYSCTTEGR; IGFKLGVRPSQGGEAPR; VTIMWTPPESAVTGYR; WSRPQAPITGYR; CDPHEATCYDDGK; LGVRPSQGGEAPR; PQAPITGYR; EINLAPDSSSVVVSGLMVATK; FTQVTPTSLSAQWTPPNVQLTGYR; WLPSSSPVTGYR; RPGGEPSPEGTTGQSYNQYSQR; TNTNVNCPIECFMPLDVQADR; TEIDKPSQMQVTDVQDNSISVK; VVTPLSPPTNLHLEANPDTGVLTVSWER; VEYELSEEGDEPQYLDLPSTATSVNIPDLLPGR; GLKPGVVYEGQLISIQQYGHQEVTR; PRPGVTEATITGLEPGTEYTIYVIALK; VDVIPVNLPGEHGQR; EESPLLIGQQSTVSDVPR; ITYGETGGNSPVQEFTVPGSK; VTWAPPPSIDLTNFLVR; DDKESVPISDTIIPAVPPPTDLR; ESVPISDTIIPAVPPPTDLR; DLEVVAATPTSLLISWDAPAVTVR; FTNIGPDTMR; GLAFTDVDVDSIK; IAWESPQGQVSR 3 IPI00022418.1, IPI00339223.1, IPI00414283.1
36 S_Total95_102 IPI00472102.1 |SWISS-PROT:P10809 |TREMBL:Q53QD5; Q96RI4; Q53SE2 |REFSEQ_NP:NP_955472; NP_002147 |ENSEMBL:ENSP00000340019; ENSP00000272817 |H-INV:HIT000031372; HIT000031088 Tax_Id=9606 60 kDa heat shock protein, mitochondrial precursor 46 GYISPYFINTSK; NAGVEGSLIVEK; TVIIEQSWGSPK; VGGTSDVEVNEK; VGEVIVTK; EIGNIISDAMK; TLNDELEIIEGMK; CIPALDSLTPANEDQK; LVQDVANNTNEEAGDGTTTATVLAR; TALLDAAGVASLLTTAEVVVTEIPK; IQEIIEQLDVTTSEYEK; VGLQVVAVK; AAVEEGIVLGGGCALLR; CEFQDAYVLLSEK; GVMLAVDAVIAELK; GVMLAVDAVIAELKK; IGIEIIK; IGIEIIKR; IQEIIEQLDVTTSEYEKEK; ISSIQSIVPALEIANAHR; KISSIQSIVPALEIANAHR; KPLVIIAEDVDGEALSTLVLNR; LKVGLQVVAVK; PVTTPEEIAQVATISANGDK; TALLDAAGVASLLTTAEVVVTEIPKEEK; CEFQDAYVLLSEKK; DRVTDALNATR; GANPVEIR; LSDGVAVLK; VGEVIVTKDDAMLLK; VTDALNATR; ALMLQGVDLLADAVAVTMGPK; APGFGDNR; DPGMGAMGGMGGGMGGGMF; EEKDPGMGAMGGMGGGMGGGMF; IMQSSSEVGYDAMAGDFVNMVEK; QSKPVTTPEEIAQVATISANGDK; RGVMLAVDAVIAELK; QSKPVTTPEEIAQVATISANGDKEIGNIISDAMK; DMAIATGGAVFGEEGLTLNLEDVQPHDLGK; PVTTPEEIAQVATISANGDKEIGNIISDAMK; YKNIGAKLVQDVANNTNEEAGDGTTTATVLAR; TLNDELEIIEGMKFDR; KQSKPVTTPEEIAQVATISANGDK; ILGEIIRK; PMF; Comb 1 IPI00472102.1
37 S_Total95_786 IPI00220967.1 |SWISS-PROT:Q9P2E9-2 Tax_Id=9606 Splice Isoform 1 of Ribosome-binding protein 1 46 DALNQATSQVESK; ELESQVSGLEK; LLATEQEDAAVAK; SIEALLEAGQAR; NTDVAQSPEAPK; SVEEEEQVWR; LIEILSEK; LKELESQVSGLEK; TAGPLESSETEEASQLK; TQLEWTEAILEDEQTQR; VEPAVSSVVNSIQVLTSK; LKGELESSDQVR; DAQDVQASQAEADQQQTR; ETSYEEALANQR; HPPAPAEPSSDLASK; LREAEETQSTLQAECDQYR; NTDVAQSPEAPKQEAPAK; SHVEDGDIAGAPASSPEAPPAEQDPVQLK; SKCEELSGLHGQLQEAR; TLQEQLENGPNTQLAR; EAEETQSTLQAECDQYR; LTAEFEEAQTSACR; QLLLESQSQLDAAK; TLVSTVGSMVFNEGEAQR; LQQENSILR; GPPDADGPLYLPYK; AMEALATAEQACK; VGAAEEELQK; EQEITAVQAR; SILAETEGMLR; EHTSHLEAELEK; AGIIQDTWHK; AQEQQQQMAELHSK; CEELSGLHGQLQEAR; GELESSDQVR; HMAAASAECQNYAK; IPDHDPAPNVTVLLR; AENSQLTER; APAVAVAPTPVQPPIIVAPVATVPAMPQEK; LTAEFEEAQTSACRLQEELEK; TEGAQGKKAER; AEGTQNQSKKAEGAPNQGR; ADSVANQGTKVEGITNQGK; EVPMVVVPPVGAK; ADSVANQGTKVEGITNQGKK; Comb; PMF 1 IPI00220967.1
38 S_Total95_1200 IPI00337335.3 |TREMBL:Q9H882; Q9BW35; Q6XYE4; Q76B62; Q7Z406; Q96I22; Q8WV23; Q5CZ75 |REFSEQ_NP:NP_079005 |ENSEMBL:ENSP00000262269 |H-INV:HIT000007217 Tax_Id=9606 Myosin heavy chain 46 EQADFAIEALAK; KEEELQAALAR; EDQSILCTGESGAGK; FDQLLAEEK; KFDQLLAEEK; LAQAEEQLEQETR; QLLQANPILEAFGNAK; AQVTELEDELTAAEDAK; FLTNGPSSSPGQER; LLGLGVTDFSR; RQEEEAGALEAGEEAR; VDYKANEWLMK; YEILTPNAIPK; CNGVLEGIR; DQADFSVLHYAGK; EQLEEEAAAR; IHEAAVQELR; QEEEAGALEAGEEAR; VAEQAANDLR; VIQYLAHVASSPK; LELQLQEVQGR; EAQAALAEAQEDLESER; AQAELENVSGALNEAESK; GELEDTLDSTNAQQELR; CNGVLEGIRICRQGFPNR; PANPPGLLALLDEECWFPK; AMEAEAAGLR; NTDQATMPDNTAAQK; LQLEKVTTEAKMK; MVSAVLQFGNIALK; LALEAEVSELR; QLEEAEEEASR; DEGEEEAEVELAESGR; DEMADEVANGNLSK; ELEDVTESAESMNR; ELQTAQAQLSEWR; GPSAGGGPGSGTSPQVEWTAR; HGQALGELAEQLEQAR; LQQELDDATMDLEQQR; LVWVPSELHGFEAAALR; ELSSTEAQLHDAQELLQEETR; KAPPRPGPVPEAAQPFLFTPR; LDGESSELQEQMVEQQQR; LQQHIQELEAHLEAEEGAR; RLELQLQEVQGR; PMF; Comb 1 IPI00337335.3
39 S_Total95_1550 IPI00013508.3 |SWISS-PROT:P12814 |TREMBL:Q86TX4; Q5ZEZ4 |REFSEQ_NP:NP_001093 |ENSEMBL:ENSP00000193403 |H-INV:HIT000037309; HIT000031614 Tax_Id=9606 Alpha-actinin 1 45 LASDLLEWIR; FAIQDISVEETSAK; TINEVENQILTR; GYEEWLLNEIR; DLLLDPAWEK; AIMTYVSSFYHAFSGAQK; VGWEQLLTTIAR; HEAFESDLAAHQDR; KHEAFESDLAAHQDR; TFTAWCNSHLR; CQLEINFNTLQTK; CQLEINFNTLQTKLRISNR; EGLLLWCQR; KTFTAWCNSHLR; ELPPDQAEYCIAR; TFTAWCNSHLRK; LMLLLEVISGER; HTNYTMEHIR; MTLGMIWTIILR; ASIHEAWTDGK; AGTQIENIEEDFR; LVSIGAEEIVDGNVK; DHSGTLGPEEFK; LAILGIHNEVSK; KDDPLTNLNTAFDVAEK; LLETIDQLYLEYAK; VEQIAAIAQELNELDYYDSPSVNAR; ACLISLGYDIGNDPQGEAEFAR; DDPLTNLNTAFDVAEK; DGLGFCALIHR; ICDQWDNLGALTQK; IDQLEGDHQLIQEALIFDNK; NVNIQNFHISWK; QFGAQANVIGPWIQTK; QKDYETATLSEIK; AGTQIENIEEDFRDGLK; ETADTDTADQVMASFK; MVSDINNAWGCLEQVEK; DYETATLSEIK; HRPELIDYGK; VLAVNQENEQLMEDYEK; MLDAEDIVGTARPDEK; NYITMDELR; ISIEMHGTLEDQLSHLR; Comb 1 IPI00013508.3
40 S_Total95_64 IPI00556624.1 |TREMBL:Q6GSJ0 |REFSEQ_NP:NP_006112 |ENSEMBL:ENSP00000252244 Tax_Id=9606 Keratin 1 44 NKYEDEINKR; LALDIEIATYR; LALDLEIATYR; FLEQQNQVLQTK; IEISELNR; LNDLEDALQQAK; SLDLDSIIAEVK; YEELQITAGR; AQYEDIAQK; SLNNQFASFIDK; DYQELMNTK; TLLEGEESR; TNAENEFVTIK; FSSCGGGGGSFGAGGGFGSR; GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR; LNDLEDALQQAKEDLAR; NMQDMVEDYR; QISNLQQSISDAEQR; SGGGFSSGSAGIINYQR; SLNNQFASFIDKVR; THNLEPYFESFINNLR; TNAENEFVTIKK; WELLQQVDTSTR; NKLNDLEDALQQAK; GSGGGSSGGSIGGRGSSSGGVK; AEAESLYQSK; AEAESLYQSKYEELQITAGR; KQISNLQQSISDAEQR; NKLNDLEDALQQAKEDLAR; QISNLQQSISDAEQRGENALK; SKAEAESLYQSK; GSGGGSSGGSIGGR; LDSELKNMQDMVEDYR; LLRDYQELMNTK; SEIDNVKK; SLDLDSIIAEVKAQYEDIAQK; SLVNLGGSK; SLVNLGGSKSISISVAR; GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR; MSGECAPNVSVSVSTSHTTISGGGSR; LDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNR; FLEQQNQVLQTKWELLQQVDTSTR; LRSEIDNVKK; Comb; PMF 1 IPI00556624.1
41 S_Total95_831 IPI00299402.1 |SWISS-PROT:P11498 |REFSEQ_NP:NP_071504; NP_000911 |ENSEMBL:ENSP00000336709; ENSP00000338125; ENSP00000347900 |H-INV:HIT000035332 Tax_Id=9606 Pyruvate carboxylase, mitochondrial precursor 44 AEAEAQAEELSFPR; ADFAQACQDAGVR; AGTHILCIK; ASPSPTDPVVPAVPIGPPPAGFR; PGASLPPLDLQALEK; ALAVSDLNR; AYSEALAAFGNGALFVEK; DFTATFGPLDSLNTR; ELIPNIPFQMLLR; ENNVDAVHPGYGFLSER; GANAVGYTNYPDNVVFK; GLAPVQAYLHIPDIIK; HIEVQILGDQYGNILHLYER; HYFIEVNSR; IAPYVAHNFSK; LDNASAFQGAVISPHYDSLLVK; QVGYENAGTVEFLVDR; SVVEFLQGYIGVPHGGFPEPFR; VFDYSEYWEGAR; VVEIAPAAHLDPQLR; FLYECPWR; IAEEFEVELER; IVGDLAQFMVQNGLSR; LLHYLGHVMVNGPTTPIPVK; QVFFELNGQLR; VEGRPGASLPPLDLQALEK; ADEAYLIGR; TSTAPAASPNVR; YSLQYYMGLAEELVR; DAHQSLLATR; AYVEANQMLGDLIK; GQIGAPMPGK; LFSMENWGGATFDVAMR; NHPGLLLMDTTFR; VVHSYEELEENYTR; ALKDVKGQIGAPMPGK; GTPLDTEVPMER; TVAIYSEQDTGQMHR; LQVEHTVTEEITDVDLVHAQIHVAEGR; TNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNR; FIEKPRHIEVQILGDQYGNILHLYER; HGEEVTPEDVLSAAMYPDVFAHFK; FIGPSPEVVR; PMF; Comb 1 IPI00299402.1
42 S_Total95_1416 IPI00020501.1 |SWISS-PROT:P35749 |TREMBL:O14794; Q16086; Q66K75 |REFSEQ_NP:NP_002465 |ENSEMBL:ENSP00000300036 |H-INV:HIT000017418 Tax_Id=9606 Myosin heavy chain, smooth muscle isoform 44 KEEELQAALAR; EDQSILCTGESGAGK; FDQLLAEEK; KFDQLLAEEK; QLLQANPILEAFGNAK; CNGVLEGIR; CNGVLEGIRICRQGFPNR; TQLEELEDELQATEDAK; ALELDPNLYR; ALEEALEAK; DLGEELEALK; LEEEEDRGQQLQAER; VVSSVLQLGNIVFK; ALEEALEAKEELER; GQLSDDEKFLFVDK; HISTLNIQLSDSK; LQDFASTVEALEEGK; NFINSPVAQADWAAK; ATQQAEQLSNELATER; IAQLEEQVEQEAR; TEFSIIHYAGK; TELEDTLDSTATQQELR; DTSITGELEK; ISDLTTNLAEEEEK; NTDQASMPDNTAAQK; QLEEAEEESQR; LEAQVQELQSK; DVASLSSQLQDTQELLQEETR; EELAEELASSLSGR; EIENLTQQYEEK; EILLQVEDER; HAQAVEELTEQLEQFK; KLQDFASTVEALEEGK; LQNEVESVTGMLNEAEGK; MAQQMLDLEEQLEEEEAAR; SLEADLMQLQEDLAAAER; ELDEATESNEAMGR; EQEVTVLKKALDEETR; IAQLEEELEEEQGNMEAMSDR; NSLQDQLDEEMEAK; LEGDASDFHEQIADLQAQIAELK; LQQELDDLVVDLDNQR; VIENADGSEEETDTR; PMF 1 IPI00020501.1
43 S_Total95_4347 IPI00328113.2 |SWISS-PROT:P35555 Tax_Id=9606 Fibrillin-1 precursor 44 CACTYGFTGPQCER; CECEIGYELDR; CECPVGFFYNDK; CPPGFYTSPDGTR; CPTGYYLNEDTR; LLVCEDIDECQNGPVCQR; NCVDINECVLNSLLCDNGQCR; NTPEYEELCPR; RGFIPNIR; TGCTDINECEIGAHNCGK; YQCACNPGYHSTPDR; CECFPGLAVGLDGR; CLCPEGFSLSSSGR; GDNGDTACSNEIGVGVSK; RGQCIKPLFGAVTK; TCVDINECLLEPR; YEDEECTLPIAGR; CICNSGYEVDSTGK; CSCSPGWIGDGIK; GEGWGDPCELCPTEPDEAFR; GTQCEDIDECEVFPGVCK; GYILQEDGR; NGLCVNTR; TLPGGNQCIVPICR; CICPPGYSLQNEK; CSNQLPQSITK; MCCCSYNIGR; NCEDMDECSIR; AGYQSTLTR; PGFQLASDGR; CDSGFALDSEER; GECIDVDECEK; YNAYCCPGWK; GTCWQTVIDGR; INQKEGISYLHFTKK; TNDDQTMCLDINECER; CWSPGVTVAPEMCPIR; GWGPHCEICPFQGTVAFKK; RPDGEGCVDENECQTKPGICENGR; TGYTPDITGTSCVDLNECNQAPKPCNFICK; TCVDVNECDLNPNICLSGTCENTK; SQCCSSLGAAWGSPCTLCQVDPICGK; AWGHPCEMCPAQPHPCR; ILCPGGEGFRPNPITVILEDIDECQELPGLCQGGK 2 IPI00471957.1, IPI00328113.2
44 S_Total95_379 IPI00022463.1 |SWISS-PROT:P02787 |TREMBL:Q53H26 |REFSEQ_NP:NP_001054 |ENSEMBL:ENSP00000264998 Tax_Id=9606 Serotransferrin precursor 43 YLGEEYVK; HSTIFENLANK; SASDLTWDNLK; ASYLDCIR; CSTSSLLEACTFR; DYELLCLDGTR; EGYYGYTGAFR; SVIPSDGPSVACVK; DGAGDVAFVK; EFQLFSSPHGK; CDEWSVNSVGK; FDEFFSEGCAPGSK; ADRDQYELLCLDNTR; EDPQTFYYAVAVVK; IECVSAETTEDCIAK; LCMGSGLNLCEPNNK; SAGWNIPIGLLYCDLPEPR; SDNCEDTPEAGYFAVAVVK; SKEFQLFSSPHGK; TAGWNIPMGLLYNK; DCHLAQVPSHTVVAR; EDLIWELLNQAQEHFGK; EGTCPEAPTDECKPVK; KPVEEYANCHLAR; KSASDLTWDNLK; LKCDEWSVNSVGK; NLNEKDYELLCLDGTR; EFQLFSSPHGKDLLFK; KASYLDCIR; KCSTSSLLEACTFR; DQYELLCLDNTR; GDVAFVKHQTVPQNTGGK; DSGFQMNQLR; WCAVSEHEATK; MYLGYEYVTAIR; EGTCPEAPTDECK; IMNGEADAMSLDGGFVYIAGK; AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK; KPVDEYKDCHLAQVPSHTVVAR; KDSGFQMNQLR; DSAHGFLKVPPR; HQTVPQNTGGKNPDPWAK; PMF; Comb 1 IPI00022463.1
45 S_Total95_7-1 IPI00555805.1 |TREMBL:Q9UM89; Q6U2E8; Q5JNX0; Q5ST67; Q6U2E5; Q6U2F6; Q6U2K2; Q5JNX2; Q6U2E7; Q6U2F3; Q9UCE5; Q6XMI6; Q6U2F0; Q6U2I5; Q6U2F4; Q96EG2; Q6U2L9; Q9UMV1; Q6U2E0; Q5JQM8; Q6P4R1 |REFSEQ_NP:NP_009224 |ENSEMBL:ENSP00000299406 |H-INV:HIT000035785 Tax_Id=9606 Complement component 4A 42 VLSLAQEQVGGSPEK; YVLPNFEVK; EELVYELNPLDHR; VTASDPLDTLGSEGALSPGGVASLLR; ALEILQEEDLIDEDDIPVR; FGLLDEDGKK; GLQDEDGYR; GPEVQLVAHSPWLK; GSFEFPVGDAVSK; STQDTVIALDALSAYWIASHTTEER; DDPDAPLQPVTPLQLFEGR; FACYYPR; ITQVLHFTK; LLATLCSAEVCQCAEGK; PVAFSVVPTAAAAVSLK; VDFTLSSER; VGDTLNLNLR; DFALLSLQVPLK; EPFLSCCQFAESLR; VDVQAGACEGK; QGSFQGGFR; AACAQLNDFLQEYGTQGCQV; EMSGSPASGIPVK; GLCVATPVQLR; TTNIQGINLLFSSR; ADGSYAAWLSR; LGQYASPTAK; LNMGITDLQGLR; LVNGQSHISLSK; PVQGVAYVR; SCGLHQLLR; AEMADQAAAWLTR; KYVLPNFEVK; LTVAAPPSGGPGFLSIER; HLVPGAPFLLQALVR; LHLETDSLALVALGALDTALYAAGSK; VQQPDCREPFLSCCQFAESLR; MRPSTDTITVMVENSHGLR; GHLFLQTDQPIYNPGQR; LQETSNWLLSQQQADGSFQDPCPVLDR; PSTDTITVMVENSHGLR; YVSHFETEGPHVLLYFDSVPTSR 1 IPI00555805.1
46 S_Total95_7-2 IPI00453459.1 |TREMBL:Q6U2F8; Q6U2L1; Q6U2L7; Q6U2G1; Q6U2G0 |REFSEQ_NP:NP_000583 Tax_Id=9606 Complement Component 4B preproprotein 42 VLSLAQEQVGGSPEK; YVLPNFEVK; EELVYELNPLDHR; VTASDPLDTLGSEGALSPGGVASLLR; ALEILQEEDLIDEDDIPVR; FGLLDEDGKK; GLQDEDGYR; GPEVQLVAHSPWLK; GSFEFPVGDAVSK; STQDTVIALDALSAYWIASHTTEER; DDPDAPLQPVTPLQLFEGR; FACYYPR; ITQVLHFTK; LLATLCSAEVCQCAEGK; PVAFSVVPTAAAAVSLK; VDFTLSSER; VGDTLNLNLR; DFALLSLQVPLK; EPFLSCCQFAESLR; VDVQAGACEGK; QGSFQGGFR; AACAQLNDFLQEYGTQGCQV; EMSGSPASGIPVK; GLCVATPVQLR; TTNIQGINLLFSSR; ADGSYAAWLSR; LGQYASPTAK; LNMGITDLQGLR; LVNGQSHISLSK; PVQGVAYVR; SCGLHQLLR; AEMADQAAAWLTR; KYVLPNFEVK; LTVAAPPSGGPGFLSIER; HLVPGAPFLLQALVR; LHLETDSLALVALGALDTALYAAGSK; VQQPDCREPFLSCCQFAESLR; MRPSTDTITVMVENSHGLR; GHLFLQTDQPIYNPGQR; PSTDTITVMVENSHGLR; LQETSNWLLSQQQADGSFQDLSPVIHR; YVSHFETEGPHVLLYFDSVPTSR 1 IPI00453459.1
47 S_Total95_61 IPI00186290.5 |SWISS-PROT:P13639 |TREMBL:Q8TA90; Q6PK56; Q58J86 |REFSEQ_NP:NP_001952 |ENSEMBL:ENSP00000307940 Tax_Id=9606 Elongation factor 2 42 ETVSEESNVLCLSK; YEWDVAEAR; ARPFPDGLAEDIDKGEVSAR; IWCFGPDGTGPNILTDITK; KIWCFGPDGTGPNILTDITK; PFPDGLAEDIDKGEVSAR; ARPFPDGLAEDIDK; DSVVAGFQWATK; GVQYLNEIKDSVVAGFQWATK; VFSGLVSTGLK; EDLYLKPIQR; KEETAKLIEK; EGIPALDNFLDK; ALLELQLEPEELYQTFQR; AYLPVNESFGFTADLR; CLYASVLTAQPR; EGIPALDNFLDKL; KEDLYLKPIQR; RCLYASVLTAQPR; STAISLFYELSENDLNFIK; STLTDSLVCK; TFCQLILDPIFK; YVEPIEDVPCGNIVGLVGVDQFLVK; DLEEDHACIPIK; VNFTVDQIR; VNFTVDQIRAIMDKK; CELLYEGPPDDEAAMGIK; GGGQIIPTAR; IMGPNYTPGK; EGALCEENMR; VTDGALVVVDCVSGVCVQTETVLR; GHVFEESQVAGTPMFVVK; PSQVVAETR; STLTDSLVCKAGIIASARAGETR; SDPMVQCIIEESGEHIIAGAGELHLEICLK; LMEPIYLVEIQCPEQVVGGIYGVLNR; WLPAGDALLQMITIHLPSPVTAQK; DGAGFLINLIDSPGHVDFSSEVTAALR; SNTGGQAFPQCVFDHWQILPGDPFDNSSR; TGTITTFEHAHNMR; NMSVIAHVDHGK; Comb; PMF 1 IPI00186290.5
48 S_Total95_668 IPI00027230.3 |SWISS-PROT:P14625 |TREMBL:Q96GW1; Q59FC6; Q5CAQ5 |REFSEQ_NP:NP_003290 |ENSEMBL:ENSP00000299767 |H-INV:HIT000034191; HIT000008733 Tax_Id=9606 Endoplasmin precursor 41 DISTNYYASQK; EEASDYLELDTIK; ELISNASDALDK; FAFQAEVNR; GVVDSDDLPLNVSR; IADDKYNDTFWK; SGYLLPDTK; LSLNIDPDAK; SILFVPTSAPR; EFEPLLNWMK; YNDTFWK; EEEAIQLDGLNASQIR; LISLTDENALSGNEELTVK; FQSSHHPTDITSLDQYVER; GYEVIYLTEPVDEYCIQALPEFDGK; KYSQFINFPIYVWSSK; LIINSLYK; TDDEVVQREEEAIQLDGLNASQIR; YSQFINFPIYVWSSK; EEKEESDDEAAVEEEEEEK; EESDDEAAVEEEEEEK; EESDDEAAVEEEEEEKKPK; LGVIEDHSNR; EAESSPFVER; TFEINPR; TETVEEPMEEEEAAK; EKSEKFAFQAEVNR; GLFDEYGSK; IKEDEDDKTVLDLAVVLFETATLR; NLLHVTDTGVGMTR; TVWDWELMNDIK; VFITDDFHDMMPK; IYFMAGSSR; ESDDPMAYIHFTAEGEVTFK; TETVEEPMEEEEAAKEEK; TVWDWELMNDIKPIWQR; LTESPCALVASQYGWSGNMER; KGYEVIYLTEPVDEYCIQALPEFDGK; TVWDWELMNDIKPIWQRPSK; ELISNASDALDKIR; PMF; Comb 1 IPI00027230.3
49 S_Total95_192 IPI00010180.3 |SWISS-PROT:P23141 |TREMBL:Q6LAP9; Q549X8; Q549X7 |REFSEQ_NP:NP_001257 |ENSEMBL:ENSP00000353720 |H-INV:HIT000035806 Tax_Id=9606 Liver carboxylesterase 1 precursor 40 AGQLLSELFTNR; FTPPQPAEPWSFVK; AGQLLSELFTNRK; FVSLEGFAQPVAIFLGIPFAKPPLGPLR; FVSLEGFAQPVAIFLGIPFAK; AISESGVALTSVLVK; LSEDCLYLNIYTPADLTK; AISESGVALTSVLVKK; FWANFAR; TPEELQAER; DAGAPTYMYEFQYR; PSFSSDMKPK; EGASEEEIR; EGYLQIGANTQAAQK; AVEKPPQTEHIEL; DKEVAFWTNLFAK; EVAFWTNLFAK; TVIGDHGDELFSVFGAPFLK; KAVEKPPQTEHIEL; NGNPNGEGLPHWPEYNQK; EGYLQIGANTQAAQKLKDK; ESQPLLGTVIDGMLLLK; GNWGHLDQVAALR; TEEELLETTLK; YLGGTDDTVK; QKTEEELLETTLK; SYPLVCIAK; FLSLDLQGDPR; DLFLDLIADVMFGVPSVIVAR; GDVKPLAEQIAITAGCK; LGIWGFFSTGDEHSR; NFHTVPYMVGINK; TTTSAVMVHCLR; KGDVKPLAEQIAITAGCK; PLAEQIAITAGCK; TAMSLLWK; WVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAK; AFILATLSASAAWGHPSSPPVVDTVHGKVLGK; QEFGWLIPMQLMSYPLSEGQLDQK; PMF; Comb 1 IPI00010180.3
50 S_Total95_1573 IPI00334775.3 |TREMBL:Q9NTK6 |ENSEMBL:ENSP00000329390 |H-INV:HIT000025139 Tax_Id=9606 Hypothetical protein DKFZp761K0511 40 ELISNASDALDK; ELISNASDALDKIR; EDQTEYLEER; YESLTDPSK; HNDDEQYAWESSAGGSFTVR; YESLTDPSKLDSGK; YIDQEELNK; ADLINNLGTIAK; EKYIDQEELNK; SIYYITGESK; HSQFIGYPITLYLEK; IEDVGSDEEDDSGK; EQVANSAFVER; FYEAFSK; GVVDSEDIPLNLSR; CLELFSELAEDKENYK; CLELFSELAEDKENYKK; CLELFSELAEDK; YHTSQSGDEMTSLSEYVSR; GVVDSEDLPLNISR; TLTIVDTGIGMTK; IDIIPNPQER; TLTLVDTGIGMTK; HFSVEGQLEFR; EGLELPEDEEEK; SLTNDWEDHLAVK; EGLELPEDEEEKK; EGLELPEDEEEKKK; APFDLFENK; RAPFDLFENK; KHSQFIGYPITLYLEK; RAPFDLFENKK; HLEINPDHPIVETLR; NPDDITQEEYGEFYK; VFIMDSCDELIPEYLNFIR; GFEVVYMTEPIDEYCVQQLK; DLVVLLFETALLSSGFSLEDPQTHSNR; KHLEINPDHPIVETLR; MIKLGLGIDEDEVAAEEPNAAVPDEIPLSR; Comb; PMF 1 IPI00334775.3
51 S_Total95_34 IPI00384697.1 |TREMBL:Q86YG0 |ENSEMBL:ENSP00000334747 Tax_Id=9606 ALB protein 39 AVMDDFAAFVEK; FKDLGEENFK; KQTALVELVK; KVPQVSTPTLVEVSR; LVTDLTK; VPQVSTPTLVEVSR; YICENQDSISSK; ADDKETCFAEEGK; FQNALLVR; LKECCEKPLLEK; AEFAEVSK; DLGEENFK; QTALVELVK; QNCELFEQLGEYK; HPDYSVVLLLR; AEFAEVSKLVTDLTK; EFNAETFTFHADICTLSEK; KLVAASQAALGL; MPCAEDYLSVVLNQLCVLHEK; RHPDYSVVLLLR; RPCFSALEVDETYVPK; SHCIAEVENDEMPADLPSLAADFVESK; VFDEFKPLVEEPQNLIK; VHTECCHGDLLECADDR; LVAASQAALGL; PLVEEPQNLIK; DVFLGMFLYEYAR; VHTECCHGDLLECADDRADLAK; CCTESLVNR; CCAAADPHECYAK; TYETTLEK; ECCEKPLLEK; ADDKETCFAEEGKK; YTKKVPQVSTPTLVEVSR; RMPCAEDYLSVVLNQLCVLHEK; TYETTLEKCCAAADPHECYAK; LSQRFPK; QNCELFEQLGEYKFQNALLVR; PMF; Comb 1 IPI00384697.1
52 S_Total95_228 IPI00218914.4 |SWISS-PROT:P00352 |TREMBL:Q5SYQ9; Q5SYR0; Q5SYQ8; Q5SYQ7 |REFSEQ_NP:NP_000680 |ENSEMBL:ENSP00000297785 |H-INV:HIT000030461 Tax_Id=9606 Retinal dehydrogenase 1 39 LADLIER; VTLELGGK; ANNTFYGLSAGVFTK; IFVEESIYDEFVR; ILDLIESGK; ILDLIESGKK; EEIFGPVQQIMK; IGPALSCGNTVVVK; QAFQIGSPWR; TIPIDGNFFTYTR; LYSNAYLNDLAGCIK; ELGEYGFHEYTEVK; GYFVQPTVFSNVTDEMR; IFINNEWHDSVSGK; VAFTGSTEVGK; YILGNPLTPGVTQGPQIDK; YILGNPLTPGVTQGPQIDKEQYDK; KFPVFNPATEEELCQVEEGDKEDVDK; LLLATMESMNGGK; PAEQTPLTALHVASLIK; RANNTFYGLSAGVFTK; SLDDVIKR; DRLLLATMESMNGGK; FPVFNPATEEELCQVEEGDKEDVDK; IAKEEIFGPVQQIMK; LECGGGPWGNK; IGPALSCGNTVVVKPAEQTPLTALHVASLIK; KYILGNPLTPGVTQGPQIDKEQYDK; HEPIGVCGQIIPWNFPLVMLIWK; SPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASR; KFPVFNPATEEELCQVEEGDK; KYILGNPLTPGVTQGPQIDK; AITISSALQAGTVWVNCYGVVSAQCPFGGFK; LLLATMESMNGGKLYSNAYLNDLAGCIK; YCAGWADK; IGFTGSTEVGK; SSSGTPDLPVLLTDLK; EAGFPPGVVNIVPGYGPTAGAAISSHMDIDK; Comb; PMF 1 IPI00218914.4
53 S_Total95_1425 IPI00477531.1 |ENSEMBL:ENSP00000351750 Tax_Id=9606 533 kDa protein 39 VAAPDVVVPTLDTVR; GIFEALRPLETLPVEGLIR; AMSRPILYSNWLSK; DFPLNDLLSATELDK; ENFIPTIVNFSAEEISDAIR; ILDDDTIITTLENLK; LEGVEGVAHIIDPK; SLLQALNEVK; SSLQSQCLNEVLK; TPVIDADKPVSSQLR; VFEEDALSWEDK; VQVALEELQDLK; AGRIFVFEPPPGVK; AWTQVLLGQAEDK; FLSDPQVHTVLVER; FTQDTQPHYIYSPR; LVPLLLEDGGEAPAALEAALEEK; EALELTDTGLLSGSEER; ITNQVIYLNPPIEECR; LGGSPFGPAGTGK; QPQGHLLLIGVSGAGK; IQFVGACNPPTDPGR; QDLADVVQVCEGK; TTDLLTDWEKTKPVTGNLR; WTDENIDTVALK; SACDTVDTWLDDTAK; SPLVMDVLNIQGVQR; IFVFEPPPGVK; IQGLTVEQAEAVVR; WAIAQLNYADMLK; TEYLSNADER; AEVDMDTDAPQVSHK; EKAMSRPILYSNWLSK; LKVNFLPEIITLSKEVR; VTDFGDKVEDPTFLNQLQSGVNR; VFYEEELDVPLVLFNEVLDHVLR; VAEVLFDAADANAIEEVNLAYENVK; KLEHLITELVHQR; Comb 2 IPI00456969.1, IPI00477531.1
54 S_Total95_2570 IPI00382470.2 |TREMBL:Q5CAQ7 |REFSEQ_NP:NP_001017963 |H-INV:HIT000013060 Tax_Id=9606 Heat shock protein HSP 90-alpha 2 39 EDQTEYLEER; YESLTDPSK; HNDDEQYAWESSAGGSFTVR; ELHINLIPNK; ELISNSSDALDK; YIDQEELNK; ADLINNLGTIAK; EKYIDQEELNK; GVVDSEDIPLNLSR; GVVDSEDLPLNISR; TLTIVDTGIGMTK; TLTLVDTGIGMTK; HFSVEGQLEFR; DQVANSAFVER; EGLELPEDEEEK; HIYYITGETK; SLTNDWEDHLAVK; HSQFIGYPITLFVEK; NPDDITNEEYGEFYK; EGLELPEDEEEKK; EGLELPEDEEEKKK; HLEINPDHSIIETLR; RAPFDLFENR; APFDLFENR; FYEQFSK; DNSTMGYMAAK; VFIMDNCEELIPEYLNFIR; YYTSASGDEMVSLK; CLELFTELAEDK; CLELFTELAEDKENYK; DQVANSAFVERLRK; HGLEVIYMIEPIDEYCVQQLK; LGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSR; KHLEINPDHSIIETLR; KHSQFIGYPITLFVEK; ESEDKPEIEDVGSDEEEEK; KHGLEVIYMIEPIDEYCVQQLK; QSQGAGQHLYK; DCPAQSAEYPRDR 1 IPI00382470.2
55 S_Total95_2571 IPI00414676.5 |SWISS-PROT:P08238 |TREMBL:Q6PK50; Q9H6X9; Q5T9W7 |REFSEQ_NP:NP_031381 |ENSEMBL:ENSP00000325875 |H-INV:HIT000032091; HIT000036733; HIT000034201; HIT000037669; HIT000035963; HIT000008644 Tax_Id=9606 Heat shock protein HSP 90-beta 39 ELISNASDALDK; ELISNASDALDKIR; EDQTEYLEER; YESLTDPSK; HNDDEQYAWESSAGGSFTVR; YESLTDPSKLDSGK; YIDQEELNK; ADLINNLGTIAK; EKYIDQEELNK; SIYYITGESK; HSQFIGYPITLYLEK; IEDVGSDEEDDSGK; EQVANSAFVER; FYEAFSK; GVVDSEDIPLNLSR; CLELFSELAEDKENYK; CLELFSELAEDKENYKK; CLELFSELAEDK; YHTSQSGDEMTSLSEYVSR; GVVDSEDLPLNISR; TLTIVDTGIGMTK; IDIIPNPQER; TLTLVDTGIGMTK; HFSVEGQLEFR; EGLELPEDEEEK; SLTNDWEDHLAVK; EGLELPEDEEEKK; EGLELPEDEEEKKK; APFDLFENK; RAPFDLFENK; KHSQFIGYPITLYLEK; RAPFDLFENKK; HLEINPDHPIVETLR; NPDDITQEEYGEFYK; VFIMDSCDELIPEYLNFIR; LGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASR; GFEVVYMTEPIDEYCVQQLK; DLVVLLFETALLSSGFSLEDPQTHSNR; KHLEINPDHPIVETLR 1 IPI00414676.5
56 S_Total95_2709 IPI00478003.1 |SWISS-PROT:P01023 |TREMBL:Q5QTS0; Q9BQ22; Q6PIY3 |REFSEQ_NP:NP_000005 Tax_Id=9606 Alpha-2-macroglobulin precursor 39 NEDSLVFVQTDK; VTAAPQSVCALR; YDVENCLANK; DTVIKPLLVEPEGLEK; QFSFPLSSEPFQGSYK; TEHPFTVEEFVLPK; AIGYLNTGYQR; ATVLNYLPK; ETTFNSLLCPSGGEVSEELSLK; FEVQVTVPK; GHFSISIPVK; HYDGSYSTFGER; KYSDASDCHGEDSQAFCEK; SLFTDLEAENDVLHCVAFAVPK; SSGSLLNNAIK; VSVQLEASPAFLAVPVEK; ALLAYAFALAGNQDK; IAQWQSFQLEGGLK; LPPNVVEESAR; NALFCLESAWK; NQGNTWLTAFVLK; QGIPFFGQVR; TEVSSNHVLIYLDK; VTGEGCVYLQTSLK; YSDASDCHGEDSQAFCEK; AGAFCLSEDAGLGISSTASLR; DLTGFPGPLNDQDDEDCINR; KDTVIKPLLVEPEGLEK; LLIYAVLPTGDVIGDSAK; AAQVTIQSSGTFSSK; DMYSFLEDMGLK; LLLQQVSLPELPGEYSMK; MVSGFIPLKPTVK; VGFYESDVMGR; VYDYYETDEFAIAEYNAPCSK; YNILPEKEEFPFALGVQTLPQTCDEPK; VVSMDENFHPLNELIPLVYIQDPK; PQYMVLVPSLLHTETTEK; LVHVEEPHTETVR 1 IPI00478003.1
57 S_Total95_1077 IPI00604607.1 |SWISS-PROT:P07900 |TREMBL:O75322; Q5CAQ6; Q96HX7; Q86U12; Q8TBA7 |REFSEQ_NP:NP_005339 |ENSEMBL:ENSP00000216281; ENSP00000335153 |H-INV:HIT000039695 Tax_Id=9606 Heat shock protein HSP 90-alpha 38 EDQTEYLEER; HNDDEQYAWESSAGGSFTVR; ELHINLIPNK; ELISNSSDALDK; YIDQEELNK; ADLINNLGTIAK; EKYIDQEELNK; GVVDSEDIPLNLSR; GVVDSEDLPLNISR; TLTIVDTGIGMTK; TLTLVDTGIGMTK; HFSVEGQLEFR; DQVANSAFVER; EGLELPEDEEEK; HIYYITGETK; SLTNDWEDHLAVK; HSQFIGYPITLFVEK; NPDDITNEEYGEFYK; EGLELPEDEEEKK; EGLELPEDEEEKKK; ELHINLIPNKQDR; HLEINPDHSIIETLR; RAPFDLFENR; APFDLFENR; FYEQFSK; DNSTMGYMAAK; VFIMDNCEELIPEYLNFIR; YYTSASGDEMVSLK; CLELFTELAEDK; CLELFTELAEDKENYK; DQVANSAFVERLRK; HGLEVIYMIEPIDEYCVQQLK; LGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSR; KHLEINPDHSIIETLR; KHSQFIGYPITLFVEK; ESEDKPEIEDVGSDEEEEK; KHGLEVIYMIEPIDEYCVQQLK; Comb; PMF 1 IPI00604607.1
58 S_Total95_3074 IPI00329745.4 |SWISS-PROT:P42704 |TREMBL:Q6ZUD8; Q53PC0; Q7Z7A6 |REFSEQ_NP:NP_573566 |ENSEMBL:ENSP00000260665 Tax_Id=9606 130 kDa leucine-rich protein 38 SGGLGGSHALLLLR; SEAANGNLDFVLSFLK; CVANNQVETLEK; DLPVTEAVFSALVTGHAR; IQEENVIPR; KEKNVQGIIEILK; LANQFAIYKPVTDFFLQLVDAGK; LGAVYDVSHYNALLK; NLLESYHVPELIK; NVQGIIEILK; SCGSLLPELK; VIEEQLEPAVEK; YAGEPVPFIEPPESFEFYAQQLR; DAGIEPGPDTYLALLNAYAEK; DTTALSFFHMLNGAALR; EGNQEVPFDVPELWYEDEK; EQNIVFNAETYSNLIK; GDLSTALEVAIDCYEK; GFTLNDAANSR; LIASYCNVGDIEGASK; SNTLPISLQSIR; TVQLTSSELESTLETLK; EVQMHSFPLQFTLHCALLANK; GDVENIEVVQK; KISNQFDWALMR; TVLDQQQTPSR; LQDAINILK; LDSSAVLDTGK; HSLNSSSASTTEPDFQK; AGYPQYVSEILEK; MEEANIQPNR; SMNINLWSEITELLYK; YIPDAMNLILLLVTEK; NNNIDAAIENIENMLTSENK; PVTDFFLQLVDAGK; VIEPQYFGLAYLFR; LDDLFLK; SVLELIPELNEK 1 IPI00329745.4
59 S_Total95_189 IPI00006663.1 |SWISS-PROT:P05091 |TREMBL:Q9UN17; Q53FB6 |REFSEQ_NP:NP_000681 |ENSEMBL:ENSP00000261733 |H-INV:HIT000031323 Tax_Id=9606 Aldehyde dehydrogenase, mitochondrial precursor 37 ANNSTYGLAAAVFTK; VAEQTPLTALYVANLIK; VIQVAAGSSNLK; AAFQLGSPWR; EEIFGPVMQILK; ELGEYGLQAYTEVK; ILGYINTGK; KILGYINTGK; LGPALATGNVVVMK; LLCGGGIAADR; TEQGPQVDETQFK; VIQVAAGSSNLKR; TIPIDGDFFSYTR; VAFTGSTEIGR; LADLIER; TIEEVVGR; YYAGWADK; VVGNPFDSK; ANYLSQALQAGTVWVNCYDVFGAQSPFGGYK; GYFIQPTVFGDVQDGMTIAK; TFVQEDIYDEFVER; EAGFPPGVVNIVPGFGPTAGAAIASHEDVDK; TFPTVNPSTGEVICQVAEGDKEDVDK; YYAGWADKYHGK; TEQGPQVDETQFKK; KTFPTVNPSTGEVICQVAEGDKEDVDK; TYLAALETLDNGK; PYVISYLVDLDMVLK; VIQVAAGSSNLKRVTLELGGK; TFPTVNPSTGEVICQVAEGDK; HEPVGVCGQIIPWNFPLLMQAWK; TYLAALETLDNGKPYVISYLVDLDMVLK; VTLELGGK; ILGYINTGKQEGAK; FKTIEEVVGR; DLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYK; PMF; Comb 1 IPI00006663.1
60 S_Total95_271 IPI00021304.1 |SWISS-PROT:P35908 |REFSEQ_NP:NP_000414 |ENSEMBL:ENSP00000310861 Tax_Id=9606 Keratin, type II cytoskeletal 2 epidermal 37 TLNNKFASFIDKVR; FASFIDK; TLNNKFASFIDK; FASFIDKVR; LLEGEECR; FLEQQNQVLQTK; DYQELMNVK; LALDVEIATYR; NLDLDSIIAEVK; IEISELNR; TAAENDFVTLK; GFSSGSAVVSGGSR; LNDLEEALQQAK; NVQDAIADAEQR; VDLLNQEIEFLK; YEELQVTVGR; TSQNSELNNMQDLVEDYKK; QSGSRGGSGGGGSISGGGYGSGGGSGGR; AQYEEIAQR; GGSISGGGYGSGGGK; SISISVAGGGGGFGAAGGFGGR; GGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGR; GGSGGGGSISGGGYGSGGGSGGR; GGSSSGGGYGSGGGGSSSVK; GSSSGGGYSSGSSSYGSGGR; HGGGGGGFGGGGFGSR; NKLNDLEEALQQAK; NKLNDLEEALQQAKEDLAR; NLDLDSIIAEVKAQYEEIAQR; TAAENDFVTLKK; YLDGLTAER; PINLEPIFQGYIDSLK; SKEEAEALYHSK; TSQNSELNNMQDLVEDYK; FGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVK; VLYDAEISQIHQSVTDTNVILSMDNSR; Comb; PMF 1 IPI00021304.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home