Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
571 S_Total95_3482 IPI00465089.1 |SWISS-PROT:Q02928 |TREMBL:Q16802; Q5VSP8; Q86SU6; Q8TCB1 |REFSEQ_NP:NP_000769 |ENSEMBL:ENSP00000311095 Tax_Id=9606 Fatty acid omega-hydroxylase 14 HLDFLDILLLAK; RLPNPCEDKDQL; VQLYDPDYMK; ELSTPVTFPDGR; LPNPCEDKDQL; FELLPDPTR; WEELLGQDSPLEVFQHVSLMTLDTIMK; CAFSHQGSIQVDR; NSQSYIQAISDLNNLVFSR; NAFHQNDTIYSLTSAGR; VWPNPEVFDPFR; WVETFPSACPHWLWGGK; ALQQFPCPPSHWLFGHIQELQQDQELQR; MLTPAFHYDILKPYVGLMADSVR 1 IPI00465089.1
572 S_Total95_3546 IPI00180313.1 |TREMBL:Q16753 Tax_Id=9606 Debrisoquine 4-hydroxylase mutant allele 14 AVSNVIASLTCGR; EVLNAVPVLLHIPALAGK; VQQEIDDVIGQVR; DEAVWEKPFR; DIEVQGFR; GTTLITNLSSVLK; LLDLAQEGLK; LLDLAQEGLKEESGFLR; AFLTQLDELLTEHR; FGDIVPLGVTHMTSR; PSHHGVFAFLVTPSPYELCAVPR; RPEMGDQAHMPYTTAVIHEVQR; GNPESSFNDENLR; YSPGPLPLPGLGNLLHVDFQNTPYCFDQLR 1 IPI00180313.1
573 S_Total95_3548 IPI00477660.1 |ENSEMBL:ENSP00000346625 Tax_Id=9606 57 kDa protein 14 AVSNVIASLTCGR; EVLNAVPVLLHIPALAGK; VQQEIDDVIGQVR; DEAVWEKPFR; DIEVQGFR; RFSVSTLR; GTTLITNLSSVLK; LLDLAQEGLK; LLDLAQEGLKEESGFLR; AFLTQLDELLTEHR; FGDIVPLGVTHMTSR; PSHHGVFAFLVTPSPYELCAVPR; RPEMGDQAHMPYTTAVIHEVQR; PPAPIYQVLGIGPRSQGKR 1 IPI00477660.1
574 S_Total95_3601 IPI00299608.3 |SWISS-PROT:Q99460-1 |TREMBL:Q53TI2 |REFSEQ_NP:NP_002798 |ENSEMBL:ENSP00000309474 Tax_Id=9606 Splice Isoform 1 of 26S proteasome non-ATPase regulatory subunit 1 14 TVGTPIASVPGSTNTGTVPGSEK; FTATASLGVIHK; DTSEDIEELVEPVAAHGPK; IEEEEQEPEPPEPFEYIDD; TPEQCPSVVSLLSESYNPHVR; AAVESLGFILFR; QCVENADLPEGEK; DNLEWLAR; LNAVVNDFWAEISESVDK; LLHVAVSDVNDDVR; QCVENADLPEGEKK; VSTAVLSITAK; QGALIASALIMIQQTEITCPK; YGAAMALGICCAGTGNK 2 IPI00299608.3, IPI00456695.1
575 S_Total95_3618 IPI00220617.3 |SWISS-PROT:P17858-2 |REFSEQ_NP:NP_001002021 |ENSEMBL:ENSP00000309438 |H-INV:HIT000032824; HIT000034670; HIT000034113 Tax_Id=9606 Similar to 6-phosphofructokinase, liver type 14 AAAYNLVQHGITNLCVIGGDGSLTGANIFR; LNIIIIAEGAIDR; SEWGSLLEELVAEGK; TGISHGHTVYVVHDGFEGLAK; TNVLGHLQQGGAPTPFDR; VFANAPDSACVIGLK; AVAFSPVTELKK; GQLESIVENIR; FDEATQLR; AVAFSPVTELK; LPLMECVQMTK; GQVQEVGWHDVAGWLGR; GGSFENNWNIYK; IMEVIDAITTTAQSHQR 1 IPI00220617.3
576 S_Total95_3679 IPI00027834.3 |SWISS-PROT:P14866 |TREMBL:Q6NTA2 |REFSEQ_NP:NP_001524 |ENSEMBL:ENSP00000221419 Tax_Id=9606 Heterogeneous nuclear ribonucleoprotein L isoform a 14 ASLNGADIYSGCCTLK; AITHLNNNFMFGQK; NPNGPYPYTLK; SSSGLLEWESK; VFNVFCLYGNVEK; NDQDTWDYTNPNLSGQGDPGSNPNKR; SDALETLGFLNHYQMK; NDQDTWDYTNPNLSGQGDPGSNPNK; NGVQAMVEFDSVQSAQR; QPAIMPGQSYGLEDGSCSYK; SKPGAAMVEMADGYAVDR; TPASPVVHIR; GLIDGVVEADLVEALQEFGPISYVVVMPK; TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK 1 IPI00027834.3
577 S_Total95_3687 IPI00247674.4 |REFSEQ_XP:XP_292820 |ENSEMBL:ENSP00000344996 Tax_Id=9606 PREDICTED: hypothetical protein XP_292820 14 ATEDCATGATGPELEAK; KGGEEEPEATKEPLEAER; RGAEEEEVEEPLGVEK; GAEEEEVEEPLGVEK; TQGTEGDLNLEQGSR; VEEVVLEAIGDR; QPEPSAPTEGEEASGPK; EDVLGFLPGPR; TGGGEETWEAEK; VPEVVQTSSPR; DEAEMSPVVER; GGEEEPEATKEPLEAER; NLEDSLFTLQSQLQLLQSASTGAQHKPSGR; EGSESQAEEMNEAGPPLEANTETRPEK 1 IPI00247674.4
578 S_Total95_3885 IPI00018465.1 |SWISS-PROT:Q99832 |TREMBL:Q6FI26; Q53HV2; Q6IBT3 |REFSEQ_NP:NP_006420 |ENSEMBL:ENSP00000258091 |H-INV:HIT000038616; HIT000023379 Tax_Id=9606 T-complex protein 1, eta subunit 14 INALTAASEAACLIVSVDETIK; LPIGDVATQYFADR; CQVFEETQIGGER; QLCDNAGFDATNILNK; TFSYAGFEMQPK; SQDAEVGDGTTSVTLLAAEFLK; ATISNDGATILK; LLDVVHPAAK; VQGGALEDSQLVAGVAFK; TATQLAVNK; GKATISNDGATILK; MVVDAVMMLDDLLQLK; VQGGALEDSQLVAGVAFKK; EGTDSSQGIPQLVSNISACQVIAEAVR 1 IPI00018465.1
579 S_Total95_3934 IPI00032064.1 |SWISS-PROT:Q9Y2D5-1 |TREMBL:Q5T721 |REFSEQ_NP:NP_009134 |ENSEMBL:ENSP00000322967 |H-INV:HIT000000637 Tax_Id=9606 Splice Isoform A of A-kinase anchor protein 2 14 LEQEIQTLESEESQISAK; WLLQGIPAGTAEEEEAR; SVNVSLTQEELDSGLDELSVR; QVLQSTQSPR; DALGDSLQVPVSPSSTTSSR; QFQLMENSRQAVAK; EDIVTEQIDFSAAR; EGESASNATETSGPDMTIK; LWAEDGEFTSAR; NLMQTLMEDYETHK; SPGALETPSAAGSQGNTASQGK; VRPSEEMLELEK; DGAEQQGPEATVEEAEAAAFGSEK; MDDSSYTSKLLSCK 1 IPI00032064.1
580 S_Total95_3958 IPI00470523.2 |TREMBL:Q641Q2 |REFSEQ_NP:NP_001005751 |H-INV:HIT000004019 Tax_Id=9606 Similar to KIAA0592 protein 14 LLEPSVGSLFGDDEDDDLFSSAK; AVASPEATVSQTDENK; TSLFEEDEEDDLFAIAK; IAENPANPPVGGK; DNDPDVDLFAGTK; ETVSEAPPLLFSDEEEK; GLFDDEDEESDLFTEAPQDR; HSDLFSSSSPWDK; SPMFPALGEASSDDDLFQSAK; VQSTADIFGDEEGDLFK; GEADLFDSGDIFSTGTGSQSVER; VYDEEVEEPVLK; VDEEPTTLPSGEAK; TNPFPLLEDEDDLFTDQK 1 IPI00470523.2
581 S_Total95_4125 IPI00306436.1 |SWISS-PROT:P40763-2 |TREMBL:Q9BXH2 |REFSEQ_NP:NP_003141 Tax_Id=9606 Splice Isoform Del-701 of Signal transducer and activator of transcription 3 14 TQIQSVEPYTK; FLQESNVLYQHNLR; GLSIEQLTTLAEK; LENWITSLAESQLQTR; LLGPGVNYSGCQITWAK; QFLAPWIESQDWAYAASK; LLVKFPELNYQLKIK; QQIACIGGPPNICLDR; QQMLEQHLQDVRK; SIVSELAGLLSAMEYVQK; IMDATNILVSPLVYLYPDIPK; SQGDMQDLNGNNQSVTR; YLEQLHQLYSDSFPMELR; LLQTAATAAQQGGQANHPTAAVVTEK 2 IPI00306436.1, IPI00412752.1
582 S_Total95_4239 IPI00029455.1 |SWISS-PROT:O95255 |REFSEQ_NP:NP_001162 |ENSEMBL:ENSP00000205557 Tax_Id=9606 Multidrug resistance-associated protein 6 14 AFVTLTVLNILNK; ASAVGDVVNLVSVDVQR; INLTVPQGCLLAVVGPVGAGK; KGALVCLLDQAR; SAITGLVYR; ALVASLPGQLQYK; GQVAESGSPAQLLAQK; TQAPFVAQNNAR; ETDTVDVDIPDK; TTSEAQTEVPLDDPDR; ISIIPQDPILFPGSLR; SSLLSALLGELSK; DRTTSEAQTEVPLDDPDRAGWPAGK; FHGWEGAFLDRVLGIRGQELGALR 1 IPI00029455.1
583 S_Total95_4284 IPI00221012.5 |SWISS-PROT:Q93008-2 |TREMBL:Q8WX12 |REFSEQ_NP:NP_004643 |ENSEMBL:ENSP00000316357 Tax_Id=9606 Splice Isoform Long of Probable ubiquitin carboxyl-terminal hydrolase FAF-X 14 ALTLQDLDNIWAAQAGK; LLLTAIGYGHVR; SGGLPLVLSMLTR; FSEYLLECPSAEVR; AQENYEGSEEVSPPQTK; LEGDNVNPESQLIQQSEQSESETAGSTK; NVSVRLAQQISDEASR; ELLAFQTSEK; FDDGDVTECK; LYSVVSQLIR; IIEDCSNSEETVK; LAQQISDEASR; FHIGCEKGGANLIK; VVIQSNDDIASR 2 IPI00003964.1, IPI00221012.5
584 S_Total95_4459 IPI00141318.1 |TREMBL:Q07065; Q53ES6 |REFSEQ_NP:NP_006816 |ENSEMBL:ENSP00000312296 Tax_Id=9606 P63 protein 14 DLSDGIHVVK; ERDFTSLENTVEER; LEGLGSSEADQDGLASTVR; SINDNIAIFTEVQK; VQSLQATFGTFESILR; TAVDSLVAYSVK; SVGELPSTVESLQK; VQEQVHTLLSQDQAQAAR; AKVASLEESEGNK; ASVSQVEADLK; STLQTMESDIYTEVR; IETNENNLESAK; DFTSLENTVEER; SSSSSSASAAAAAAAASSSASCSR 1 IPI00141318.1
585 S_Total95_4466 IPI00215768.2 |SWISS-PROT:P48506 |REFSEQ_NP:NP_001489 |ENSEMBL:ENSP00000229416 |H-INV:HIT000019795 Tax_Id=9606 Glutamate--cysteine ligase catalytic subunit 14 DPLTLFEEK; LGCPGFTLPEVKPNPVEGGASK; NTPSPFIETFTEDDEASR; SRYDSIDSYLSK; SLFFPDEAINK; VVINVPIFK; WGVISASVDDR; FKPPPPNSDIGWR; GLLSQGSPLSWEETK; EATSILEENQALCTITSFPR; QDSVITDEMNYSLILK; LGCPGFTLPEVK; CNQIANELCECPELLGSAFR; EGVFPGLIPILNSYLENMEVDVDTR 1 IPI00215768.2
586 S_Total95_4508 IPI00182757.6 |TREMBL:Q8N3G7; Q9H9Q9; Q8N8M1; Q9NT55; Q6P0Q9; Q8N163; Q8TF34 |REFSEQ_NP:NP_066997; NP_954675 |ENSEMBL:ENSP00000310670 |H-INV:HIT000021402; HIT000020567; HIT000029081; HIT000028892; HIT000025811; HIT000001682; HIT000029082; HIT000005935 Tax_Id=9606 P30 DBC protein 14 EAAPDAGAEPITADSDPAYSSK; VVTQNICQYR; QRAGGEPWGAKK; DEAQNEGPATESEAPLK; AAYNPGQAVPWNAVK; EEAAKEEATKEEEAIK; SPAPPLLHVAALGQK; TLAAEMQELR; VLLLSSPGLEELYR; VQTLSNQPLLK; FAEFQYLQPGPPR; RDLERILLTLGIR; EEVVKEPKDEAQNEGPATESEAPLK; AAEAAPPTQEAQGETEPTEQAPDALEQAADTSR 1 IPI00182757.6
587 S_Total95_4880 IPI00479324.2 |TREMBL:Q66K23; Q5VZA9; Q14052 |REFSEQ_NP:NP_001837 |ENSEMBL:ENSP00000353654 |H-INV:HIT000009186 Tax_Id=9606 AlphA 2 type IV collAgen preproprotein 14 GLDGYQGPDGPR; AHNQDLGLAGSCLAR; GTPGEMGPPGLGLPGLK; IAVQPGTVGPQGR; AGFPGLPGSPGAPGPKGWK; GDRGSPGMDGFQGMPGLK; GIQGMPGIPGLSGIPGLPGRPGHIK; LWSGYSLLYFEGQEK; AGLYGEIGATGDFGDIGDTINLPGR; GDEGPIGHQGPIGQEGAPGR; GEQGFMGNTGPTGAVGDR; GLPGEVLGAQPGPR; SVSIGYLLVK; RGPPGAPGEMGPQGPPGEPGFRGAPGK 1 IPI00479324.2
588 S_Total95_6324 IPI00299024.8 |SWISS-PROT:P80723 |TREMBL:Q9BWA5 |REFSEQ_NP:NP_006308 |ENSEMBL:ENSP00000319281 |H-INV:HIT000029700 Tax_Id=9606 Brain acid soluble protein 1 14 ESEPQAAAEPAEAK; ETPAATEAPSSTPK; SDGAPASDSKPGSSEAAPSSK; TEAPAAPAAQETK; APEQEQAAPGPAAGGEAPK; AEPPKAPEQEQAAPGPAAGGEAPK; AAEAAAAPAESAAPAAGEEPSK; KTEAPAAPAAQETK; AAEAAAAPAESAAPAAGEEPSKEEGEPK; AEGAATEEEGTPK; AQGPAASAEEPKPVEAPAANSDQTVTVK; PVEAPAANSDQTVTVK; AQGPAASAEEPKPVEAPAANSDQTVTVKE; PGSSEAAPSSKETPAATEAPSSTPK 1 IPI00299024.8
589 S_Total95_16 IPI00043744.3 |TREMBL:Q96NM0 |REFSEQ_NP:NP_694558 |ENSEMBL:ENSP00000282512 |H-INV:HIT000011772; HIT000014557 Tax_Id=9606 Hypothetical protein FLJ30596 13 SEASGPQLLPVR; YTHSFPEALQK; ALNEVFIGESLSSR; VATQAVEDVLNIAK; LKPVIGVNTDPER; QGNLSLPLNR; VTNEYNESLLYSPEEPK; ILFSIREPIANR; SEGHLCLPVR; LYLEGTGINPVPVDLHEQQLSLNQHNR; SSGLNLCTGTGSK; ASYYEISVDDGPWEK; Comb; PMF 1 IPI00043744.3
590 S_Total95_77 IPI00216308.4 |SWISS-PROT:P21796 |TREMBL:Q5FVE7 |REFSEQ_NP:NP_003365 |ENSEMBL:ENSP00000265333 |H-INV:HIT000033820; HIT000020844 Tax_Id=9606 Voltage-dependent anion-selective channel protein 1 13 LTLSALIDGK; LTFDSSFSPNTGK; VTQSNFAVGYK; YQIDPDACFSAK; VNNSSLIGLGYTQTLKPGIK; LTFDSSFSPNTGKK; SENGLEFTSSGSANTETTK; TDEFQLHTNVNDGTEFGGSIYQK; TKSENGLEFTSSGSANTETTK; WNTDNTLGTEITVEDQLAR; WTEYGLTFTEK; KLETAVNLAWTAGNSNTR; PMF; Comb 1 IPI00216308.4
591 S_Total95_81 IPI00215925.4 |SWISS-PROT:Q14749 |TREMBL:Q5T8W2 |REFSEQ_NP:NP_061833 |ENSEMBL:ENSP00000244689 |H-INV:HIT000041639 Tax_Id=9606 Glycine N-methyltransferase 13 DVTTSVLIVNNK; VWQLYIGDTR; NYDHILSTGCAPPGK; SLGVAAEGLPDQYADGEAAR; LSYYPHCLASFTELLQAAFGGK; AGGLLVIDHR; WVIEEANWMTLDK; AWLLGLLR; AHMVTLDYTVQVPGAGQDGSPGLSK; PYKPGQTYIPCYFIHVLK; DVPQSAEGGFDAVICLGNSFAHLPDCK; VLDVACGTGVDSIMLVEEGFSVTSVDASDK; PMF; Comb 1 IPI00215925.4
592 S_Total95_89 IPI00029488.1 |SWISS-PROT:P50053-1 |TREMBL:Q53G56; Q6IBK2 |REFSEQ_NP:NP_000212 |ENSEMBL:ENSP00000260599 |H-INV:HIT000032690 Tax_Id=9606 Splice Isoform A of Ketohexokinase 13 HLGFQSAEEALR; LLHSDAFPPPR; CGLQGFDGIV; EELFQLFGYGDVVFVSK; VVDTLGAGDTFNASVIFSLSQGR; GAVLVCAWAEEGADALGPDGK; KGAVLVCAWAEEGADALGPDGK; FGCQVAGK; VSVEVEKPR; FGCQVAGKKCGLQGFDGIV; VSVEVEKPREELFQLFGYGDVVFVSK; YTVFQTTGSVPIATVIINEASGSR; Comb; PMF 1 IPI00029488.1
593 S_Total95_134 IPI00000875.5 |SWISS-PROT:P26641 |TREMBL:Q53YD7 |REFSEQ_NP:NP_001395 |ENSEMBL:ENSP00000331901 |H-INV:HIT000029573; HIT000036406; HIT000039323; HIT000040479; HIT000032886; HIT000033551; HIT000032895; HIT000022134; HIT000017654; HIT000037343; HIT000041202; HIT000034626 Tax_Id=9606 Elongation factor 1-gamma 13 ALIAAQYSGAQVR; EYFSWEGAFQHVGK; KLDPGSEETQTLVR; LDPGSEETQTLVR; GQELAFPLSPDWQVDYESYTWR; ILGLLDAYLK; WFLTCINQPQFR; DGWSLWYSEYR; VLSAPPHFHFGQTNR; AAAPAPEEEMDECEQALAAEPK; DPFAHLPK; YSNEDTLSVALPYFWEHFDK; AKDPFAHLPK 1 IPI00000875.5
594 S_Total95_141 IPI00291274.2 |TREMBL:Q8WV27; Q9NWP8 |REFSEQ_NP:NP_060401 |ENSEMBL:ENSP00000334692 |H-INV:HIT000015127; HIT000038471 Tax_Id=9606 FLJ20699 protein 13 LFDATLTQYVK; IVQLGGSNAQR; VLELLLPIR; DVGLPLCQALVEAEDGNPDR; IYPFWTPDIPLSSYVK; LDKELDLAVK; SLGGIEGCLSK; WQDVLPVAR; LPLSTTSNEACK; DASESPGENCQHLLAR; LQMEGVSVGQR; ACELWEQILQDHPTDMLALK; Comb; PMF 2 IPI00550644.2, IPI00291274.2
595 S_Total95_165 IPI00453473.4 |SWISS-PROT:P62805 |TREMBL:Q6B823; Q6DRA9 |REFSEQ_NP:NP_003530; NP_003535; NP_068803; NP_003529; NP_778224; NP_003486; NP_003534; NP_003532; NP_003536; NP_003539; NP_003537; NP_003531; NP_003533 |ENSEMBL:ENSP00000327355; ENSP00000350767; ENSP00000353624; ENSP00000352980; ENSP00000346316; ENSP00000349037; ENSP00000348258; ENSP00000329043; ENSP00000289352; ENSP00000244484; ENSP00000347168; ENSP00000350159; ENSP00000343282; ENSP00000349849 |H-INV:HIT000035123; HIT000037968 Tax_Id=9606 Histone H4/o 13 ISGLIYEETR; VFLENVIR; DNIQGITKPAIR; TLYGFGG; KTVTAMDVVYALK; RISGLIYEETR; TVTAMDVVYALK; KTVTAMDVVYALKR; RKTVTAMDVVYALK; TVTAMDVVYALKR; DNIQGITK; DAVTYTEHAK; Comb; PMF 1 IPI00453473.4
596 S_Total95_246 IPI00019568.1 |SWISS-PROT:P00734 |TREMBL:Q53H04; Q69EZ8; Q7Z7P3; Q86WA1; Q69EZ7; Q15253; Q53H06; Q8TD58 |REFSEQ_NP:NP_000497 |ENSEMBL:ENSP00000308541 Tax_Id=9606 Prothrombin precursor 13 ETAASLLQAGYK; HQDFNSAVQLVENFCR; KPVAFSDYIHPVCLPDR; SEGSSVNLSPPLEQCVPDR; LAACLEGNCAEGLGTNYR; SGIECQLWR; TATSEYQTFFNPR; TFGSGEADCGLRPLFEK; ELLESYIDGR; LAVTTHGLPCLAWASAQAK; NPDGDEEGVWCYVAGK; NPDSSTTGPWCYTTDPTVR; Comb; PMF 1 IPI00019568.1
597 S_Total95_254 IPI00215965.1 |SWISS-PROT:P09651-1 |REFSEQ_NP:NP_112420 |ENSEMBL:ENSP00000341826 Tax_Id=9606 Heterogeneous nuclear ribonucleoprotein A1 isoform b 13 IFVGGIKEDTEEHHLR; KIFVGGIKEDTEEHHLR; LFVGGIKEDTEEHHLR; LFIGGLSFETTDESLR; GFAFVTFDDHDSVDK; SSGPYGGGGQYFAK; SSGPYGGGGQYFAKPR; GGNFSGRGGFGGSR; NQGGYGGSSSSSSYGSGR; IEVIEIMTDR; GFGFVTYATVEEVDAAMNAR; DYFEKYGK; Comb; PMF 2 IPI00215965.1, IPI00465365.2
598 S_Total95_262 IPI00165360.4 |SWISS-PROT:P25325 |TREMBL:Q96GI4; Q59HD5; Q6FHN9 |REFSEQ_NP:NP_001013454; NP_001013458; NP_066949 |ENSEMBL:ENSP00000342333; ENSP00000312420 |H-INV:HIT000037660; HIT000034373; HIT000031566; HIT000012347; HIT000038417 Tax_Id=9606 3-mercaptopyruvate sulfurtransferase 13 ALVSAQWVAEALR; TYEDIKENLESR; AGQPLQLLDASWYLPK; DGIEPGHIPGTVNIPFTDFLSQEGLEK; AFGHHAVSLLDGGLR; AQLDPAFIK; ARPEDVISEGR; HIPGAAFFDIDQCSDR; LGVGAATHVVIYDASDQGLYSAPR; PDVPIYDGSWVEWYMR; TSPYDHMLPGAEHFAEYAGR; SQPAPAEFR; PMF; Comb 1 IPI00165360.4
599 S_Total95_291 IPI00329600.3 |TREMBL:Q9Y363; Q8TAR0; Q5VTK4; Q8NBX0 |REFSEQ_NP:NP_057086 |ENSEMBL:ENSP00000271981 |H-INV:HIT000040135 Tax_Id=9606 Hypothetical protein FLJ90697 13 AGGVFTPGAAFSK; SAIYGFGDQSNLR; GVYIIGSSGFDSIPADLGVIYTR; NVSNLKPVPLIGPK; QATVVLNCVGPYR; SAIYGFGDQSNLRK; AGGVFTPGAAFSKTK; GYSIPFMGSDVSVVR; LPWAVAGR; GPEAGYVATPIAMVQAAMTLLSDASHLPK; ACIENGASCIDISGEPQFLELMQLK; LGRPTLSSEVGIIICDIANPASLDEMAK; PTLSSEVGIIICDIANPASLDEMAK 1 IPI00329600.3
600 S_Total95_311 IPI00384051.4 |SWISS-PROT:Q9UL46 |TREMBL:Q86SZ7; Q6FHK9 |REFSEQ_NP:NP_002809 |ENSEMBL:ENSP00000216802 |H-INV:HIT000038705; HIT000009854; HIT000031893 Tax_Id=9606 Proteasome activator complex subunit 2 13 IEDGNDFGVAIQEK; DEAAYGELR; CILVITWIQHLIPK; TKVEAFQTTISK; VLSLLALVKPEVWTLK; TKVEAFQTTISKYFSER; VEAFQTTISK; ALVHERDEAAYGELR; IIYLNQLLQEDSLNVADLTSLR; AFYAELYHIISSNLEK; QNLFQEAEEFLYR; APLDIPIPDPPPK; Comb; PMF 1 IPI00384051.4
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home