Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
601 S_Total95_325 IPI00166866.3 |TREMBL:Q8N5K4 |H-INV:HIT000041467 Tax_Id=9606 MGC27165 protein 13 DASGVTFTWTPSSGK; WLQGSQELPR; TFTCTAAYPESK; TPLTATLSK; QEPSQGTTTFAVTSILR; NFPPSQDASGDLYTTSSQLTLPATQCLAGK; SGNTFRPEVHLLPPPSEELALNELVTLTCLAR; KGDTFSCMVGHEALPLAFTQK; DLCGCYSVSSVLPGCAEPWNHGK; GFSPKDVLVR; SAVQGPPDRDLCGCYSVSSVLPGCAEPWNHGK; GTTVTVSSASPTSPK; Comb 1 IPI00166866.3
602 S_Total95_339 IPI00027626.2 |SWISS-PROT:P40227 |TREMBL:Q59ET3 |REFSEQ_NP:NP_001753 |ENSEMBL:ENSP00000275603 Tax_Id=9606 T-complex protein 1, zeta subunit 13 ALQFLEEVK; AQLGVQAFADALLIIPK; GIDPFSLDALSK; VHAELADVLTEAVVDSILAIK; VLAQNSGFDLQETLVK; TEVNSGFFYK; GIDPFSLDALSKEGIVALR; MLVSGAGDIK; NAIDDGCVVPGAGAVEVAMAEALIK; QADLYISEGLHPR; VATAQDDITGDGTTSNVLIIGELLK; DGNVLLHEMQIQHPTASLIAK; PMF; Comb 1 IPI00027626.2
603 S_Total95_371 IPI00022488.1 |SWISS-PROT:P02790 |TREMBL:Q9BS19 |REFSEQ_NP:NP_000604 |ENSEMBL:ENSP00000265983 |H-INV:HIT000032438 Tax_Id=9606 Hemopexin precursor 13 GGYTLVSGYPK; NFPSPVDAAFR; YYCFQGNQFLR; SGAQATWTELPWPHEK; EVGTPHGIILDSVDAAFICPGSSR; GECQAEGVLFFQGDR; EWFWDLATGTMK; LLQDEFPGIPSPLDAAVECHR; DYFMPCPGR; PDPDVTERCSDGWSFDATTLDDNGTMLFFK; SLGPNSCSANGPGLYLIHGPNLYCYSDVEK; NFPSPVDAAFRQGHNSVFLIK; PMF; Comb 1 IPI00022488.1
604 S_Total95_487 IPI00026119.4 |SWISS-PROT:P22314 |TREMBL:Q5JRR6; Q712V1; Q5JRS0; Q5JRR8; Q5JRR9 |REFSEQ_NP:NP_695012; NP_003325 |ENSEMBL:ENSP00000340158; ENSP00000338413 |H-INV:HIT000036096; HIT000022197 Tax_Id=9606 Ubiquitin-activating enzyme E1 13 DEFEGLFK; AAVATFLQSVQVPEFTPK; AENYDIPSADR; IIPAIATTTAAVVGLVCLELYK; LAGTQPLEVLEAVQR; NGFLNLALPFFGFSEPLAAPR; QPAENVNQYLTDPK; ATLPSPDKLPGFK; LEELKATLPSPDK; FEVQGLQPNGEEMTLK; LDQPMTEIVSR; FVERTLRLAGTQPLEVLEAVQR; Comb; PMF 1 IPI00026119.4
605 S_Total95_497 IPI00218782.2 |SWISS-PROT:P47756-2 |TREMBL:Q5TG66; Q5VVZ6; Q5VVZ7; Q5VVZ9; Q5U0L4; Q5TG69; Q5VVZ8; Q5VVZ5 |REFSEQ_NP:NP_004921 |ENSEMBL:ENSP00000264203 |H-INV:HIT000033647 Tax_Id=9606 Capping protein (Actin filament) muscle Z-line, beta 13 NLSDLIDLVPSLCEDLLSSVDQPLK; KLEVEANNAFDQYR; STLNEIYFGK; LEVEANNAFDQYR; LTSTVMLWLQTNK; DYLLCDYNR; NDLVEALKR; DETVSDCSPHIANIGR; SGSGTMNLGGSLTR; SGSGTMNLGGSLTRQMEK; YDPPLEDGAMPSAR; GCWDSIHVVEVQEK; PMF; Comb 1 IPI00218782.2
606 S_Total95_500-1 IPI00178083.2 |ENSEMBL:ENSP00000308847 Tax_Id=9606 29 kDa protein 13 IQLVEEELDR; EDKYEEEIK; LEEAEKAADESER; RIQLVEEELDR; IQVLQQQADDAEER; TIDDLEDKLK; MEIQEIQLK; MLDQTLIDLNEM; KLVIIEGDLER; KIQVLQQQADDAEER; LVIIEGDLER; EQAEAEVASLNR; PMF; Comb 1 IPI00178083.2
607 S_Total95_500-2 IPI00479185.1 |TREMBL:Q5VU66; Q5VU63 Tax_Id=9606 Tropomyosin 3 13 IQLVEEELDR; EDKYEEEIK; LEEAEKAADESER; RIQLVEEELDR; IQVLQQQADDAEER; TIDDLEDKLK; MEIQEIQLK; MLDQTLIDLNEM; KLVIIEGDLER; KIQVLQQQADDAEER; LVIIEGDLER; EQAEAEVASLNR; Comb; PMF 1 IPI00479185.1
608 S_Total95_500-3 IPI00218319.2 |SWISS-PROT:P06753-2 |TREMBL:Q5VU59; Q5VU64; Q8NI98; Q5HYB6 |REFSEQ_NP:NP_705935 |ENSEMBL:ENSP00000325749 |H-INV:HIT000037111; HIT000029910; HIT000013503; HIT000009833 Tax_Id=9606 Tropomyosin alpha 3 chain (Tropomyosin 3) (Tropomyosin gamma). SPLICE ISOFORM 2 13 IQLVEEELDR; EDKYEEEIK; LEEAEKAADESER; RIQLVEEELDR; IQVLQQQADDAEER; TIDDLEDKLK; MEIQEIQLK; MLDQTLIDLNEM; KLVIIEGDLER; KIQVLQQQADDAEER; LVIIEGDLER; EQAEAEVASLNR; PMF; Comb 1 IPI00218319.2
609 S_Total95_529 IPI00024913.1 |SWISS-PROT:P30042-1 |REFSEQ_NP:NP_004640 |ENSEMBL:ENSP00000291577 |H-INV:HIT000030837; HIT000031621 Tax_Id=9606 Splice Isoform Long of ES1 protein homolog, mitochondrial precursor 13 NLSTFAVDGK; ITDLANLSAANHDAAIFPGGFGAAK; GVEVTVGHEQEEGGK; PIGLCCIAPVLAAK; WPYAGTAEAIK; GKITDLANLSAANHDAAIFPGGFGAAK; WPYAGTAEAIKALGAK; ALVASRLAAASAFTSLSPGGR; EVVEAHVDQK; GGAEVQIFAPDVPQMHVIDHTK; GVEVTVGHEQEEGGKWPYAGTAEAIK; EFHQAGKPIGLCCIAPVLAAK; PMF; Comb 1 IPI00024913.1
610 S_Total95_543 IPI00550451.1 |SWISS-PROT:P62136 |REFSEQ_NP:NP_002699 |ENSEMBL:ENSP00000326031 |H-INV:HIT000030723; HIT000031979; HIT000033587 Tax_Id=9606 Serine/threonine protein phosphatase PP1-alpha catalytic subunit 13 EIFLSQPILLELEAPLK; LLEVQGSRPGK; TFTDCFNCLPIAAIVDEK; AHQVVEDGYEFFAK; GKQSLETICLLLAYK; IKYPENFFLLR; NVQLTENEIR; LNLDSIIGR; QSLETICLLLAYK; YGQFSGLNPGGR; IYGFYDECK; YGQFSGLNPGGRPITPPR; PMF; Comb 1 IPI00550451.1
611 S_Total95_580 IPI00171438.2 |SWISS-PROT:Q8NBS9 |TREMBL:Q5TCQ0; Q6EHZ3; Q658S9 |REFSEQ_NP:NP_110437 |ENSEMBL:ENSP00000336896 |H-INV:HIT000030215; HIT000027920 Tax_Id=9606 Thioredoxin domain containing protein 5 precursor 13 FVLSQAKDEL; EYVESQLQR; ALAPTWEQLALGLEHSETVK; GYPTLLLFR; GYPTLLWFR; VDCTQHYELCSGNQVR; TETGATETVTPSEAPVLAAEPEADK; VDCTAHSDVCSAQGVR; TLAPTWEELSK; IAEVDCTAER; GTVLALTENNFDDTIAEGITFIK; LLPLLAR; PMF; Comb 1 IPI00171438.2
612 S_Total95_589 IPI00442121.1 |TREMBL:Q6ZMU0 |REFSEQ_NP:NP_001003945 Tax_Id=9606 Hypothetical protein FLJ16678 13 LAEVALAYAK; CVLIFGVPSR; EALMAHGLGNR; GSAADSEESPAIEAIHLLR; FASCFYGPFR; AAVLEAMTAFR; AGADIIITYYTPQLLQWLK; AGCQVVAPSDMMDGR; CYQLPPGAR; LEEMLRPLVEEGLR; RLEEMLRPLVEEGLR; DVPDDIQPITSLPGVAR; PMF; Comb 1 IPI00442121.1
613 S_Total95_626 IPI00291005.7 |SWISS-PROT:P40925 |TREMBL:Q6I9V0 |REFSEQ_NP:NP_005908 |ENSEMBL:ENSP00000233114 |H-INV:HIT000030445 Tax_Id=9606 Malate dehydrogenase, cytoplasmic 13 DVIATDKEDVAFK; FVEGLPINDFSR; ENFSCLTR; NVIIWGNHSSTQYPDVNHAK; DLDVAILVGSMPR; ELTEEKESAFEFLSSA; EVGVYEALKDDSWLK; GEFVTTVQQR; VIVVGNPANTNCLTASK; VLVTGAAGQIAYSLLYSIGNGSVFGK; EKMDLTAKELTEEK; ESAFEFLSSA; Comb 1 IPI00291005.7
614 S_Total95_663 IPI00018272.3 |SWISS-PROT:Q9NVS9 |REFSEQ_NP:NP_060599 |ENSEMBL:ENSP00000225573 |H-INV:HIT000003871 Tax_Id=9606 Pyridoxine-5'-phosphate oxidase 13 FFTNFESR; SSQIGAVVSHQSSVIPDR; EAFEETHLTSLDPVK; ELDSNPFASLVFYWEPLNR; NEELEQLYQDQEVPKPK; GEEDWLYER; GLPTGDSPLGPMTHR; NEELEQLYQDQEVPK; KLPEEEAECYFHSR; LPEEEAECYFHSR; KNEELEQLYQDQEVPKPK; KLPEEEAECYFHSRPK; PMF; Comb 1 IPI00018272.3
615 S_Total95_713-1 IPI00013860.3 |SWISS-PROT:P31937 |TREMBL:Q546Z2 |REFSEQ_NP:NP_689953 |ENSEMBL:ENSP00000265395 |H-INV:HIT000041490; HIT000008832 Tax_Id=9606 3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor 13 DLGLAQDSATSTK; SPILLGSLAHQIYR; EFQDAGEQVVSSPADVAEK; KGSLLIDSSTIDPAVSK; DFSSVFQFLR; DFSSVFQFLREEETF; GSLLIDSSTIDPAVSK; HGYPLIIYDVFPDACK; KDFSSVFQFLR; MGAVFMDAPVSGGVGAAR; TPVGFIGLGNMGNPMAK; IITMLPTSINAIEAYSGANGILK; PMF; Comb 1 IPI00013860.3
616 S_Total95_713-2 IPI00479966.1 |TREMBL:Q5XKI1 Tax_Id=9606 Hypothetical protein 13 DLGLAQDSATSTK; SPILLGSLAHQIYR; EFQDAGEQVVSSPADVAEK; KGSLLIDSSTIDPAVSK; DFSSVFQFLR; DFSSVFQFLREEETF; GSLLIDSSTIDPAVSK; HGYPLIIYDVFPDACK; KDFSSVFQFLR; MGAVFMDAPVSGGVGAAR; TPVGFIGLGNMGNPMAK; IITMLPTSINAIEAYSGANGILK; PMF; Comb 1 IPI00479966.1
617 S_Total95_717 IPI00220342.4 |SWISS-PROT:O94760 |TREMBL:Q5HYC8; Q5VWX2 |REFSEQ_NP:NP_036269 |ENSEMBL:ENSP00000352644; ENSP00000284031 |H-INV:HIT000041899 Tax_Id=9606 NG,NG-dimethylarginine dimethylaminohydrolase 1 13 EFFVGLSK; GAEILADTFK; ALPESLGQHALR; DENATLDGGDVLFTGR; DYAVSTVPVADGLHLK; LTVPDDIAANCIYLNIPNK; QHQLYVGVLGSK; VDGLLTCCSVLINK; TPEEYPESAK; DHMLIPVSMSELEK; LQLNIVEMK; SFCSMAGPNLIAIGSSESAQK; PMF; Comb 1 IPI00220342.4
618 S_Total95_736 IPI00549319.2 |TREMBL:Q6NUR7 |H-INV:HIT000026256 Tax_Id=9606 Villin 2 13 APDFVFYAPR; IGFPWSEIR; KPDTIEVQQMK; LFFLQVK; RKPDTIEVQQMK; FYPEDVAEELIQDITQK; IALLEEAR; SQEQLAAELAEYTAK; QLLTLSSELSQAR; LEADRMAALRAK; EGILSDEIYCPPETAVLLGSYAVQAK; RKEDEVEEWQHR; PMF; Comb 1 IPI00549319.2
619 S_Total95_757 IPI00329742.1 |TREMBL:Q96GK7; Q9Y3B0 |REFSEQ_NP:NP_057128 |ENSEMBL:ENSP00000233379 |H-INV:HIT000034339 Tax_Id=9606 Fumarylacetoacetate hydrolase domain containing 2A 13 ALAAQLPVLPR; EQNVPVPK; KGDEVQCEIEELGVIINK; TMTQFLEQGEATLSVAR; TFDTFCPLGPALVTK; GDEVQCEIEELGVIINK; ATDAMAHVAGFTVAHDVSAR; TMTQFLEQGEATLSVARR; VVCVGMNYVDHCK; APHLVGPHLGLETGNGGGVINLNAFDPTLPK; SEVTFLAPVTRPDK; VNGEVVQSGNTNQMVFK; PMF; Comb 1 IPI00329742.1
620 S_Total95_780 IPI00303335.1 |SWISS-PROT:P20929 |TREMBL:Q14918; Q53QQ2; Q7Z2R0; Q6PJ54; Q96MF8; Q6P516; Q53TG8; Q9Y5Z1; Q14214 |REFSEQ_NP:NP_004534 |ENSEMBL:ENSP00000172853 |H-INV:HIT000021742; HIT000013608; HIT000021758 Tax_Id=9606 Nebulin 13 GIGWSPLGSLEAEK; VAQAQKALSDVAYKK; ENLHYTTVADRPDIK; YILLPDAMNIELTR; YTIDPELPQFIQAK; QKGHHIGAQSIEDDPK; EAYEKQKGHHIGAQSIEDDPK; GIGWIPIGSLEVEK; KEGYDLRLDAIPIQAAK; SLQDDPKLVLSMNVAK; KAYDLQSDAIYKSDLEWLR; TSDYEQSETSKPALAQPALAQPASAKPVER; PMF; Comb 1 IPI00303335.1
621 S_Total95_798 IPI00419262.1 |SWISS-PROT:P23284 |TREMBL:Q9BVK5; Q6IBH5 |REFSEQ_NP:NP_000933 |ENSEMBL:ENSP00000300026 |H-INV:HIT000041441; HIT000038969; HIT000030155; HIT000034019 Tax_Id=9606 PPIB protein 13 TVDNFVALATGEK; VIFGLFGK; DKPLKDVIIADCGK; DTNGSQFFITTVK; IEVEKPFAIAK; DVIIADCGK; DFMIQGGDFTR; VLEGMEVVR; HYGPGWVSMANAGK; FPDENFK; IGDEDVGR; LKHYGPGWVSMANAGK; PMF; Comb 1 IPI00419262.1
622 S_Total95_810 IPI00015911.1 |SWISS-PROT:P09622 |TREMBL:Q8WTS4; Q59EV8 |REFSEQ_NP:NP_000099 |ENSEMBL:ENSP00000205402 |H-INV:HIT000038384; HIT000038401 Tax_Id=9606 Dihydrolipoyl dehydrogenase, mitochondrial precursor 13 SEEQLKEEGIEYK; IDVSIEAASGGK; EANLAASFGK; LNLDKMMEQK; NETLGGTCLNVGCIPSK; ALTGGIAHLFK; NLGLEELGIELDPR; ADGGTQVIDTK; AEVITCDVLLVCIGR; IPNIYAIGDVVAGPMLAHK; VCHAHPTLSEAFR; VLGAHILGPGAGEMVNEAALALEYGASCEDIAR; PMF; Comb 1 IPI00015911.1
623 S_Total95_854 IPI00011284.1 |SWISS-PROT:P21964 |TREMBL:Q6IB07; Q7KZP0 |REFSEQ_NP:NP_000745 |ENSEMBL:ENSP00000207636 |H-INV:HIT000035552 Tax_Id=9606 Catechol O-methyltransferase 13 DKVTLVVGASQDIIPQLK; GSSCFECTHYQSFLEYR; GTVLLADNVICPGAPDFLAHVR; ILNHVLQHAEPGNAQSVLEAIDTYCEQK; KGTVLLADNVICPGAPDFLAHVR; LITIEINPDCAAITQR; VTLVVGASQDIIPQLK; YLPDTLLLEECGLLR; YDVDTLDMVFLDHWK; KYDVDTLDMVFLDHWK; IVDAVIQEHQPSVLLELGAYCGYSAVR; KYDVDTLDMVFLDHWKDR; PMF; Comb 1 IPI00011284.1
624 S_Total95_907 IPI00220487.3 |SWISS-PROT:O75947-1 |REFSEQ_NP:NP_006347 |ENSEMBL:ENSP00000301587 |H-INV:HIT000001766; HIT000020526 Tax_Id=9606 ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d isoform a 13 SCAEWVSLSK; YTAQVDAEEK; SWNETLTSR; AGLVDDFEKK; KYPYWPHQPIENL; YTAQVDAEEKEDVK; AGLVDDFEK; YPYWPHQPIENL; LAALPENPPAIDWAYYK; TIDWVAFAEIIPQNQK; NLIPFDQMTIEDLNEAFPETK; VPVPEDKYTAQVDAEEKEDVK; PMF; Comb 1 IPI00220487.3
625 S_Total95_1029 IPI00216026.1 |SWISS-PROT:P45880-3 |ENSEMBL:ENSP00000298468 Tax_Id=9606 Splice Isoform 3 of Voltage-dependent anion-selective channel protein 2 13 LTFDTTFSPNTGK; LTLSALVDGK; YQLDPTASISAK; SCSGVEFSTSGSSNTDTGK; NNFAVGYR; TGDFQLHTNVNDGTEFGGSIYQK; VNNSSLIGVGYTQTLRPGVK; WNTDNTLGTEIAIEDQICQGLK; LTFDTTFSPNTGKK; VCEDLDTSVNLAWTSGTNCTR; VNNSSLIGVGYTQTLR; PMCIPPSYADLGK; Comb 3 IPI00455531.1, IPI00411815.1, IPI00216026.1
626 S_Total95_1060 IPI00219774.2 |SWISS-PROT:P13861 |REFSEQ_NP:NP_004148 |ENSEMBL:ENSP00000296446 Tax_Id=9606 cAMP-dependent protein kinase type II-alpha regulatory subunit 13 NISHYEEQLVK; APASVLPAATPR; ADEHVIDQGDDGDNFYVIER; GQYFGELALVTNKPR; KMFESFIESVPLLK; MFESFIESVPLLK; DGGNQEVEIAR; NLDQEQLSQVLDAMFER; AATIVATSEGSLWGLDR; AASAYAVGDVK; MFGSSVDLGNLGQ; VSVCAETYNPDEEEEDTDPR; PMF; Comb 1 IPI00219774.2
627 S_Total95_1072 IPI00032179.2 |SWISS-PROT:P01008 |TREMBL:Q7KZ97; Q9UE54; Q5TC78 |REFSEQ_NP:NP_000479 |ENSEMBL:ENSP00000236260 Tax_Id=9606 Antithrombin III variant 13 VAEGTQVLELPFK; DDLYVSDAFHK; FATTFYQHLADSK; SKLPGIVAEGR; TSDQIHFFFAK; NDNDNIFLSPLSISTAFAMTK; AFLEVNEEGSEAAASTAVVIAGR; IEDGFSLK; ITDVIPSEAINELTVLVLVNTIYFK; EQLQDMGLVDLFSPEK; ADGESCSASMMYQEGK; EVPLNTIIFMGR; PMF; Comb 1 IPI00032179.2
628 S_Total95_1097 IPI00007812.1 |SWISS-PROT:P21281 |TREMBL:Q59HF3 |REFSEQ_NP:NP_001684 |ENSEMBL:ENSP00000276390 |H-INV:HIT000031428 Tax_Id=9606 Vacuolar ATP synthase subunit B, brain isoform 13 AVVQVFEGTSGIDAK; IYPEEMIQTGISAIDGMNSIAR; NFIAQGPYENR; GIVNGAAPELPVPTGGPAVGAR; TSCEFTGDILR; QIYPPINVLPSLSR; HVLVILTDMSSYAEALR; IPQSTLSEFYPR; YAEIVHLTLPDGTK; IPIFSAAGLPHNEIAAQICR; GPVVLAEDFLDIMGQPINPQCR; GIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPR; Comb; PMF 1 IPI00007812.1
629 S_Total95_1104 IPI00021435.2 |SWISS-PROT:P35998 |TREMBL:Q75L23 |REFSEQ_NP:NP_002794 |ENSEMBL:ENSP00000292644 |H-INV:HIT000031017 Tax_Id=9606 26S protease regulatory subunit 7 13 ALDEGDIALLK; QTLQSEQPLQVAR; ESDTGLAPPALWDLAADK; IATEKDFLEAVNK; QVEDDIQQLLK; FDDGAGGDNEVQR; FVNLGIEPPK; ACLIFFDEIDAIGGAR; TMLELINQLDGFDPR; GVLLFGPPGTGK; YQIHIPLPPK; KIATEKDFLEAVNK; Comb; PMF 1 IPI00021435.2
630 S_Total95_1173 IPI00216719.1 |SWISS-PROT:Q8IUD2-1 |REFSEQ_NP:NP_829884 |ENSEMBL:ENSP00000354158 Tax_Id=9606 Splice Isoform 1 of RAB6 interacting protein 2 13 EASLLDLK; DEASKITIWK; TGEPCVAELTEENFQR; DEASKITIWKEQYR; EDNLNDSSQQLQDSLRKK; SLQADTTNTDTALTTLEEALAEK; EDNLNDSSQQLQDSLR; EMVLAQEESAR; IEELEEALR; LLEILKEVENEK; LAEAEMHVHHLESLLEQK; AAGLQAEIGQVK; PMF 1 IPI00216719.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home