Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
631 S_Total95_1177 IPI00305969.1 |TREMBL:Q71RH4; Q9H7G6; Q96I38 |REFSEQ_NP:NP_115754 |ENSEMBL:ENSP00000338323; ENSP00000349245 |H-INV:HIT000007824 Tax_Id=9606 EEF1D protein 13 IASLEVENQSLR; GVVQELQQAISK; SIQLDGLVWGASK; SGLGPADLALLGLSAER; LQIQCVVEDDK; VGTDLLEEEITK; ATAPQTQHVSPMR; SLAGSSGPGASSGTSGDHGELVVR; FYEQMNGPVAGASR; FEEHVQSVDIAAFNK; LQIQCVVEDDKVGTDLLEEEITK; KLQIQCVVEDDKVGTDLLEEEITK; PMF; Comb 1 IPI00305969.1
632 S_Total95_1227-1 IPI00395750.3 |TREMBL:Q53GN4; Q53H17; Q59ER5 |H-INV:HIT000029427 Tax_Id=9606 WD repeat-containing protein 1 isoform 1 variant 13 LATGSDDNCAAFFEGPPFK; GPVTDVAYSHDGAFLAVCDASK; VFASLPQVER; LYSILGTTLKDEGK; YAPSGFYIASGDVSGK; FATASADGQIYIYDGK; YEYQPFAGK; LYSILGTTLK; MTVDESGQLISCSMDDTVR; CFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVR; AHDGGIYAISWSPDSTHLLSASGDK; SYIYSGSHDGHINYWDSETGENDSFAGK; Comb; PMF 1 IPI00395750.3
633 S_Total95_1227-2 IPI00556374.2 |SWISS-PROT:O75083-1 |TREMBL:Q9BZT4 |REFSEQ_NP:NP_059830 |ENSEMBL:ENSP00000264785 |H-INV:HIT000023991; HIT000030935 Tax_Id=9606 WD repeat-containing protein 1 isoform 1 13 LATGSDDNCAAFFEGPPFK; GPVTDVAYSHDGAFLAVCDASK; VFASLPQVER; LYSILGTTLKDEGK; YAPSGFYIASGDVSGK; FATASADGQIYIYDGK; YEYQPFAGK; LYSILGTTLK; MTVDESGQLISCSMDDTVR; CFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVR; AHDGGIYAISWSPDSTHLLSASGDK; SYIYSGSHDGHINYWDSETGENDSFAGK; Comb; PMF 1 IPI00556374.2
634 S_Total95_1264 IPI00604692.1 |TREMBL:Q53FF5 |H-INV:HIT000001821 Tax_Id=9606 P47 protein isoform a variant 13 LGAAPEEESAYVAGEK; LGSTAPQVLSTSSPAQQAENEAK; ASSSILINESEPTTNIQIR; RGEVPAELR; SYQDPSNAQFLESIR; EFVAVTGAEEDR; EANLLNAVIVQR; GAKEHGAVAVERVTK; KSPNELVDDLFK; SPNELVDDLFK; PAMAATSFILMTTFPNKELADESQTLK; LAHGGQVNLDMEDHR; PMF; Comb 1 IPI00604692.1
635 S_Total95_1292 IPI00304071.3 |TREMBL:Q96CM8; Q9H7G2 |REFSEQ_NP:NP_079425 |ENSEMBL:ENSP00000300441 |H-INV:HIT000036531; HIT000007847; HIT000035621 Tax_Id=9606 Hypothetical protein FLJ20920 13 LKDGEETTVEEIK; AASGLLSIGLCK; EALVVLHEDVR; GATLSHYNIVNNSNILGER; YIVFVTNYPLTISGK; VQEVQVVGVK; DGEETTVEEIK; QICPEVENAQPGALK; VQEVQVVGVKDDR; MVSTPIGGLSYVQGCTK; DLVVAYGTTENSPVTFAHFPEDTVEQK; QHLDQLQYNQQFLSCHDPINIQFTSGTTGSPK; Comb 1 IPI00304071.3
636 S_Total95_1332 IPI00337741.4 |SWISS-PROT:P13798 |REFSEQ_NP:NP_001631 |ENSEMBL:ENSP00000296456 |H-INV:HIT000030455; HIT000029553; HIT000030678 Tax_Id=9606 Acylamino-acid-releasing enzyme 13 ALDVSASDDEIAR; GSTGFGQDSILSLPGNVGHQDVK; QVLLSEPEEAAALYR; SALYYVDLIGGK; SFNLSALEK; TPLLLMLGQEDR; QPALSAACLGPEVTTQYGGQYR; RSALYYVDLIGGK; VGFLPSAGK; CELLSDDSLAVSSPR; MGFAVLLVNYR; VTSVVVDVVPR; Comb; PMF 1 IPI00337741.4
637 S_Total95_1365 IPI00142768.2 |SWISS-PROT:Q8WXK8 |TREMBL:Q5TBT2; Q5TF24 |REFSEQ_NP:NP_065121 |ENSEMBL:ENSP00000354508 Tax_Id=9606 Bullous pemphigoid antigen 1, 230/240kDa 13 GDLRYITISGNRVLEAAK; FILADGASQGMAAFR; VNNSGISLCNLISAVTTPAK; TAEVLLDARGSLLPAK; QKISSEEISTK; FPASSLYPSGSQTQIETK; MQSSADLIIQEFMDLR; GQQMLARCPKSAETNIDQDINNLK; YRPDLIDMNTVAVQSNLANLEHAFYVAEK; DSFKLINSQFPFPQITNNEELNQK; ENLLNHEMVLKDVLPPIIK; FQDQFLGIAAINISLPGEQYGQK; PMF 1 IPI00142768.2
638 S_Total95_1378 IPI00071360.1 |TREMBL:Q9NZD3; Q9NQ94; Q9NQX9 |REFSEQ_NP:NP_620310 |ENSEMBL:ENSP00000282641 Tax_Id=9606 APOBEC-1 stimulating protein 13 YGGPPPGWDAAPPER; LAPQILEEICQK; VTEGVVDVIVYPSAADK; EFNNIKPGAVER; LLGVCASVDNCR; TGYSLVQENGQR; ITIPALASQNPAIHPFTPPK; LYDILPGMELTPMNPVTLKPQGIK; VLDGSPIEVTLAKPVDK; DLFEDELIPLCEK; GFAFVEYESHR; NNWGQPVYQLHSAIGQDQR; Comb; PMF 2 IPI00299499.1, IPI00071360.1
639 S_Total95_1394 IPI00297646.2 |SWISS-PROT:P02452 |TREMBL:Q9UMA6; O76045; Q6LAN8; Q8N473; Q14042; Q59F64 |REFSEQ_NP:NP_000079 |ENSEMBL:ENSP00000225964 Tax_Id=9606 AlphA 1 type I collAgen preproprotein 13 STGGISVPGPMGPSGPR; GETGPAGPAGPVGPVGAR; SGDRGETGPAGPAGPVGPVGAR; DGEAGAQGPPGPAGPAGER; GESGPSGPAGPTGAR; NSVAYMDQQTGNLKKALLLK; VLCDDVICDETK; GEAGPQGPR; GSPGADGPAGAPGTPGPQGIAGQR; GETGPAGPPGAPGAPGAPGPVGPAGK; GPAGPQGPR; GPPGPMGPPGLAGPPGESGR; Comb 1 IPI00297646.2
640 S_Total95_1402 IPI00063523.5 |TREMBL:Q8N800 |REFSEQ_XP:XP_062871 |ENSEMBL:ENSP00000320210 |H-INV:HIT000022349; HIT000028411 Tax_Id=9606 PREDICTED: similar to Centromeric protein E (CENP-E protein) 13 KIILNPK; NQINTIQLSERKIILNPK; KELEASNAKQSIQLQK; ESSDAGRIACPEATHGELSSDVK; HQEEKVQECEGEPGVVLTK; QDRTGRPHVILTK; LDNIQAYKPDDLK; SLSISIMRSPHTDPK; LLPLKSEDSVNGEVLTGAIK; TDLFQFNASMQQEK; YTLSYLNDITGDSNRTK; VSSDKLDNIQAYKPDDLK; PMF 1 IPI00063523.5
641 S_Total95_1417 IPI00296635.4 |SWISS-PROT:Q04446 |TREMBL:Q59ET0 |REFSEQ_NP:NP_000149 |ENSEMBL:ENSP00000264326 |H-INV:HIT000035657 Tax_Id=9606 1,4-alpha-glucan branching enzyme 13 NIGENEGGIDK; IVLDSDAAEYGGHQR; LFAYSSWEVLR; PYSLLVYIPSR; CIAYAESHDQALVGDK; VALILQNVDLPN; YGWLAAPQAYVSEK; GYESFGVHR; IYESHVGISSHEGK; HFTCNVLPR; PEDYEAALNAALADVPELAR; LITHGLGGEGYLNFMGNEFGHPEWLDFPR; Comb 1 IPI00296635.4
642 S_Total95_1488 IPI00297084.5 |SWISS-PROT:P39656 |TREMBL:Q5VWA5 |REFSEQ_NP:NP_005207 |ENSEMBL:ENSP00000235894 |H-INV:HIT000042202; HIT000031020 Tax_Id=9606 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit precursor 13 NTLLIAGLQAR; SSLNPILFR; WVFKEEGVLR; TLVLLDNLNVR; YSQTGNYELAVALSR; ELGSECGIEFDEEK; LGYTHLYSSTQVSVRPLQHTQYER; TADDPSLSLIK; WVPFDGDDIQLEFVR; LPDVYGVFQFK; NTLLIAGLQARNNAR; TAVIDHHNYDISDLGQHTLIVADTENLLK; Comb; PMF 1 IPI00297084.5
643 S_Total95_1563 IPI00298308.5 |TREMBL:Q6AI55; Q8N922; Q68D62 |REFSEQ_XP:XP_090294 |ENSEMBL:ENSP00000258494 |H-INV:HIT000020682 Tax_Id=9606 PREDICTED: similar to RIKEN cDNA D330038I09 13 HGSIIYHPSILPR; YFAGWCDK; KVSLELGGK; IPQPEEGATYEGIQK; IQGSTIPINQAR; YFAGWCDKIQGSTIPINQARPNR; PAQVTPLTALK; FLFPEGIK; IQGSTIPINQARPNR; LPQPEEGATYEGIQK; HGSIIYHPSLLPR; SCAVSNLKKVSLELGGK; Comb 1 IPI00298308.5
644 S_Total95_1619 IPI00012079.1 |SWISS-PROT:P23588 Tax_Id=9606 Eukaryotic translation initiation factor 4B 13 AASIFGGAKPVDTAAR; SPPYTAFLGNLPYDVTEESIK; GLNISAVR; TISLTDFLAEDGGTGGGSTYVSK; PVSWADETDDLEGDVSTTWHSNDDDVYR; EEDCHSPTSKPPKPDQPLK; SQSSDTEQQSPTSGGGK; VAPAQPSEEGPGR; ARPATDSFDDYPPR; PATDSFDDYPPR; VDVADQAQDK; GFGYAEFEDLDSLLSALSLNEESLGNR; Comb; PMF 1 IPI00012079.1
645 S_Total95_1686 IPI00394758.1 |SWISS-PROT:P51648-2 |ENSEMBL:ENSP00000345774 |H-INV:HIT000030886 Tax_Id=9606 Splice Isoform 2 of Fatty aldehyde dehydrogenase 13 DILTAIAADLCK; ILSLLEGQK; NVDEAINFINER; YIAPTVLTDVDPK; EKDILTAIAADLCK; IAFGGETDEATR; VMQEEIFGPILPIVPVK; SPCYIDKDCDLDIVCR; FDHIFYTGNTAVGK; DCDLDIVCR; LLPQYLDQDLYIVINGGVEETTELLK; HLTPVTLELGGK; Comb 2 IPI00333619.4, IPI00394758.1
646 S_Total95_1696 IPI00027252.6 |TREMBL:Q7KYU3; Q99623; Q9BXV3 |REFSEQ_NP:NP_009204 |H-INV:HIT000001949; HIT000036850 Tax_Id=9606 B-cell receptor-associated protein BAP37 13 IVQAEGEAEAAK; VLPSIVNEVLK; LGLDYEER; FNASQLITQR; IGGVQQDTILAEGLHFR; IYLTADNLVLNLQDESFTR; AQVSLLIR; ESVFTVEGGHR; LLLGAGAVAYGVR; PNAQELPSMYQR; DFSLILDDVAITELSFSR; IPWFQYPIIYDIR; Comb; PMF 1 IPI00027252.6
647 S_Total95_1879 IPI00479431.1 |ENSEMBL:ENSP00000351604 Tax_Id=9606 47 kDa protein 13 LLLSSETPIEGK; LLEYDTVTR; GLFEVNPWK; EPPLLLGVLHPNTK; FVPRYSLVLELSDSGAFRR; LENGEIETIAR; YSLVLELSDSGAFR; RPLRPQVVTDDDGQAPEAK; GGADLFVENMPGFPDNIR; FPNGVQLSPAEDFVLVAETTMAR; LFENQLVGPESIAHIGDVMFTGTADGR; SLHDPDGLVATYISEVHEHDGHLYLGSFR; PMF 1 IPI00479431.1
648 S_Total95_2369 IPI00005859.1 |TREMBL:O95678; Q9NSA9 |REFSEQ_NP:NP_004684 |ENSEMBL:ENSP00000252245 Tax_Id=9606 Cytokeratin type II 13 AQYEDIANR; TLNNKFASFIDKVR; FASFIDK; TLNNKFASFIDK; FASFIDKVR; LLEGEECR; FLEQQNKVLETK; LALDVEIATYR; NLDLDSIIAEVK; YEELQVTAGR; AEAESWYQTK; MSRQSSITFQSGSRR; ISSAGASFGSRSLYNLGGAKR 1 IPI00005859.1
649 S_Total95_2385 IPI00442522.1 |TREMBL:Q6ZNV1; Q9UDE9 Tax_Id=9606 Hypothetical protein FLJ27077 13 DLADELALVDVIEDK; DQLIYNLLK; LVIITAGAR; LIIVSNPVDILTYVAWK; TLHPDLGTDKDK; TLHPDLGTDKDKEQWK; VIGSGCNLDSAR; DQLIYNLLKEEQTPQNK; LKGEMMDLQHGSLFLR; NVNIFKFIIPNVVK; GEMMDLQHGSLFLR; ITVVGVGAVGMACAISILMK; LGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLK 1 IPI00442522.1
650 S_Total95_2425 IPI00032137.1 |SWISS-PROT:Q08043 |REFSEQ_NP:NP_001095 Tax_Id=9606 Alpha-actinin 3 13 FAIQDISVEETSAK; DLLLDPAWEK; HEAFESDLAAHQDR; TFTAWCNSHLR; CQLEINFNTLQTK; EGLLLWCQR; KTFTAWCNSHLR; TFTAWCNSHLRK; LMLLLEVISGER; MTLGMIWTIILR; AGTQIENIEEDFR; ERGAIMGIQGEIQK; KAGTQIENIEEDFRNGLK 1 IPI00032137.1
651 S_Total95_2451 IPI00550438.1 |H-INV:HIT000038646 Tax_Id=9606 Ig gamma-1 chain C region 13 NQVSLTCLVK; EPQVYTLPPSR; STSGGTAALGCLVK; VVSVLTVLHQDWLNGK; GPSVFPLAPSSK; FNWYVDGVEVHNAK; TPEVTCVVVDVSHEDPEVK; THTCPPCPAPELLGGPSVFLFPPKPK; THTCPPCPAPELLGGPSVFLFPPK; EPQVYTLPPSRDELTK; GFYPSDIAVEWESNGQPENNYK; TTPPVLDSDGSFFLYSK; SEDTAVYYCAR 1 IPI00550438.1
652 S_Total95_2495 IPI00003480.1 |SWISS-PROT:Q16696 Tax_Id=9606 Cytochrome P450 2A13 13 DFIDSFLIR; EALVDQAEEFSGR; SDAFVPFSIGK; YGPVFTIHLGPR; IQEEAGFLIDALR; KSDAFVPFSIGK; RFSIATLR; TVSNVISSIVFGDR; HVGFATIPR; NPNTEFYLK; NYTMSFLPR; DFIDSFLIRMQEEEK; LPPGPTPLPFIGNYLQLNTEQMYNSLMK 2 IPI00418684.2, IPI00003480.1
653 S_Total95_2500 IPI00291467.5 |SWISS-PROT:P12236 |TREMBL:Q6I9V5; Q59EI9; Q5JQ50 |REFSEQ_NP:NP_001627 |ENSEMBL:ENSP00000306222 |H-INV:HIT000033933; HIT000033489; HIT000033126; HIT000036852; HIT000041389; HIT000034089 Tax_Id=9606 Solute carrier family 25, member A6 13 QIFLGGVDK; YFPTQALNFAFK; YFAGNLASGGAAGATSLCFVYPLDFAR; AAYFGVYDTAK; GNLANVIR; GLGDCLVK; LLLQVQHASK; GAWSNVLR; GMGGAFVLVLYDEIK; GMGGAFVLVLYDEIKK; EQGVLSFWR; QIFLGGVDKHTQFWR; DFLAGGIAAAISK 1 IPI00291467.5
654 S_Total95_2692 IPI00008274.3 |SWISS-PROT:Q01518 |TREMBL:Q5T0S1; Q6I9U6; Q5T0R5; Q5T0R7; Q5T0R2; Q5T0R9; Q5T0R3; Q5T0S2; Q5T0R6; Q5T0R1; Q5T0R8; Q5T0R4 |REFSEQ_NP:NP_006358 |ENSEMBL:ENSP00000344832 |H-INV:HIT000036430 Tax_Id=9606 Adenylyl cyclase-associated protein 1 13 LSDLLAPISEQIK; NSLDCEIVSAK; VPTISINK; VENQENVSNLVIEDTELK; AGAAPYVQAFDSLLAGPVAEYLK; ALLVTASQCQQPAENK; LGLVFDDVVGIVEIINSK; SALFAQINQGESITHALK; EFHTTGLAWSK; SSEMNVLIPTEGGDFNEFPVPEQFK; ELSGLPSGPSAGSGPPPPPPGPPPPPVSTSSGSDESASR; HAEMVHTGLK; INSITVDNCK 1 IPI00008274.3
655 S_Total95_2724 IPI00289551.1 |TREMBL:O75452; Q9UNV2 |REFSEQ_NP:NP_003699 |ENSEMBL:ENSP00000266988 Tax_Id=9606 Sterol/retinol dehydrogenase 13 TESVAAAAQWVK; VSLFGGGYCISK; YVFITGCDSGFGK; YGVEAFSDSLR; LETVTLDVTK; GLWGLVNNAGISLPTAPNELLTK; SFLEIWDR; DKGLWGLVNNAGISLPTAPNELLTK; GQTSDRLETVTLDVTK; VLAACLTEK; DKYVFITGCDSGFGK; VVNVSSVMGR; VAMIEPGYFK 1 IPI00289551.1
656 S_Total95_2773 IPI00451965.1 |SWISS-PROT:P19224 |TREMBL:Q5DSZ8 |REFSEQ_NP:NP_001063 |ENSEMBL:ENSP00000303174 |H-INV:HIT000038698 Tax_Id=9606 UDP-glucuronosyltransferase 1-6 precursor, microsomal 13 AMAIADALGK; GAGVTLNVLEMTSEDLENALK; IPQTVLWR; WLPQNDLLGHPMTR; DIVEVLSDR; YQSFGNNHFAER; KIYPVPYDQEELK; SFLTAPQTEYR; IYPVPYDQEELK; DVDIITLYQK; YEELASAVLK; LLVVPQDGSHWLSMK; SPDPVSYIPR 1 IPI00451965.1
657 S_Total95_2784 IPI00178352.3 |SWISS-PROT:Q14315-1 |TREMBL:Q59H94 |REFSEQ_NP:NP_001449 |ENSEMBL:ENSP00000327145 |H-INV:HIT000003522 Tax_Id=9606 Splice Isoform 1 of Filamin C 13 EAGAGGLSIAVEGPSK; LIALLEVLSQK; DLAEDAPWKK; LIALLEVLSQKR; GAGTGGLGLTVEGPCEAK; LLGWIQNK; GQHVPGSPFQFTVGPLGEGGAHK; APSGNEEPCLLKRLPNR; GAGGQGQLDVRMTSPSR; RQAPSIATIGSTCDLNLK; TSQLNVGTSTDVSLK; CSGPGLGAGVRARVPQTFTVDCSQAGR; LLGWIQNKVPQLPITNFNRDWQDGK 2 IPI00413958.2, IPI00178352.3
658 S_Total95_2786 IPI00552858.1 |TREMBL:Q5HY90 Tax_Id=9606 Filamin A, alpha 13 DGSCGVAYVVQEPGDYEVSVK; EAGAGGLAIAVEGPSK; AEISFEDR; AEISFEDRK; VTYCPTEPGNYIINIK; DAGYGGLSLSIEGPSK; FNEEHIPDSPFVVPVASPSGDAR; VDINTEDLEDGTCR; AEAGVPAEFSIWTR; THEAEIVEGENHTYCIR; GQHVPGSPFQFTVGPLGEGGAHK; VSGQGLHEGHTFEPAEFIIDTR; ISQSEIGDASR 1 IPI00552858.1
659 S_Total95_2852 IPI00383879.5 |SWISS-PROT:P22760 |REFSEQ_NP:NP_001077 |ENSEMBL:ENSP00000232892 |H-INV:HIT000041479 Tax_Id=9606 Arylacetamide deacetylase 13 LDAVVVSTNYR; FWSEYFTTDR; GHVYNNPNYGSSELAK; GLPLTYVITCQYDLLR; IGISGDSAGGNLAAAVTQQLLDDPDVK; LINQYIEWLK; YHFPIQFEDVYNALR; FINWSSLLPERFIK; MMWINAHLK; FNNILVRVYVPK; IQSLIYPALQPLDVDLPSYQENSNFLFLSK; TIQNLATFVELLGLHHFMDSFK; NTGVQVTHNHVEDGFHGAFSFLGLK 1 IPI00383879.5
660 S_Total95_2907 IPI00016910.1 |SWISS-PROT:Q99613 |TREMBL:Q9BW98 |REFSEQ_NP:NP_003743 |ENSEMBL:ENSP00000332604 |H-INV:HIT000030496; HIT000011980; HIT000003214; HIT000029715 Tax_Id=9606 Eukaryotic translation initiation factor 3 subunit 8 13 QGTYGGYFRDQK; ELLGQGLLLR; DAHNALLDIQSSGR; KLNEILQAR; TCHSFIINEK; LNEILQAR; TEPTAQQNLALQLAEK; FEELTNLIR; ILADLEDYLNELWEDK; GTEITHAVVIK; GCILTLVER; LDEEEEDNEGGEWER; MIINEELMASLDQPTQTVVMHR 1 IPI00016910.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home