Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
661 S_Total95_2924 IPI00554660.1 |SWISS-PROT:Q9P0Z9 |REFSEQ_NP:NP_057602 |ENSEMBL:ENSP00000317721 |H-INV:HIT000006047; HIT000034109; HIT000010770 Tax_Id=9606 Peroxisomal sarcosine oxidase 13 TDIGDVQILSSFVR; LTPSYDLAPFR; VVEINPGLLVTVK; YDNIVIGAGFSGHGFK; GEVGLLDNSGGVIYAYK; SLVITAGPWTNQLLR; PLGIEMPLQTLR; AYLEDFYTR; INVCYWR; SLVITAGPWTNQLLRPLGIEMPLQTLR; VSYHHGNHADPEER; VEHQCLSSEELK; MMHECYQIWAQLEHEAGTQLHR 2 IPI00554660.1, IPI00009757.3
662 S_Total95_2925 IPI00549309.1 |TREMBL:Q6IAJ9 |H-INV:HIT000001952 Tax_Id=9606 Peroxisomal sarcosine oxidase 13 TDIGDVQILSSFVR; VVEINPGLLVTVK; YDNIVIGAGFSGHGFK; GEVGLLDNSGGVIYAYK; SLVITAGPWTNQLLR; PLGIEMPLQTLR; AYLEDFYTR; INVCYWR; SLVITAGPWTNQLLRPLGIEMPLQTLR; VSYHHGNHADPEER; VEHQCLSSEELK; MMHECYQIWAQLEHEAGTQLHR; MSQMKGVSLR 1 IPI00549309.1
663 S_Total95_2927 IPI00019160.1 |SWISS-PROT:P78329 |TREMBL:Q6NWT5 |REFSEQ_NP:NP_001073 |ENSEMBL:ENSP00000221700 Tax_Id=9606 Cytochrome P450 4F2 13 TLPSQGVDDFLQAK; LVHDFTDAVIQER; TLDFIDVLLLSK; TLDFIDVLLLSKDEDGK; AEGGLWLR; IFNESVNIMHAK; MLTPAFHFNILK; VLTQLVATYPQGFK; GIICLISVFGTHHNPAVWPDPEVYDPFR; VVLALTLLR; HVTQDIVLPDGR; SVINASAAIAPK; VWMGPISPLLSLCHPDIIR 1 IPI00019160.1
664 S_Total95_2950 IPI00298828.1 |SWISS-PROT:P02749 |REFSEQ_NP:NP_000033 |ENSEMBL:ENSP00000205948 |H-INV:HIT000040179; HIT000038905 Tax_Id=9606 Beta-2-glycoprotein I precursor 13 ATVVYQGER; FICPLTGLWPINTLK; TCPKPDDLPFSTVVPLK; TFYEPGEEITYSCK; WSPELPVCAPIICPPPSIPTFATLR; ATFGCHDGYSLDGPEEIECTK; CSYTEDAQCIDGTIEVPK; KCSYTEDAQCIDGTIEVPK; VCPFAGILENGAVR; KFICPLTGLWPINTLK; TFYEPGEEITYSCKPGYVSR; TDASDVKPC; DKATFGCHDGYSLDGPEEIECTK 1 IPI00298828.1
665 S_Total95_2962 IPI00256376.4 |TREMBL:Q5W0J6; Q9BVL8; Q96DC8; Q9H7G4; Q53HR9; Q5W0J7; Q8WYY8 |REFSEQ_NP:NP_078969 |ENSEMBL:ENSP00000256880 |H-INV:HIT000034476; HIT000007836 Tax_Id=9606 Enoyl Coenzyme A hydratase domain containing 3 variant 13 DGQEGITAFLQK; NIVLSNPK; SLQSDILHDADSNDLK; SSFATPGVNVGLFCSTPGVALAR; VIIISAEGPVFSSGHDLK; KIASLSRPVVSLGK; VVPEAELQEETMR; DYHAEVFQTCSK; QLPQDLGTAYYLTSQAMVDNLALR; NTLSLAMLK; QLDGIRNIVLSNPK; VALEMLFTGEPISAQEALLHGLLSK; IASLSRPVVSLGK 1 IPI00256376.4
666 S_Total95_3217 IPI00219078.5 |SWISS-PROT:P16615-1 |REFSEQ_NP:NP_733765 |ENSEMBL:ENSP00000324892 Tax_Id=9606 Splice Isoform SERCA2B of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 13 VDQSILTGESVSVIK; SLPSVETLGCTSVICSDK; TASEMVLADDNFSTIVAAVEEGR; IAVALAVAAIPEGLPAVITTCLALGTRRMAK; VGEATETALTCLVEK; TGTLTTNQMSVCR; EFDELNPSAQR; IGIFGQDEDVTSK; DIVPGDIVEIAVGDK; EWGSGSDTLR; NYLEPGKECVQPATK; ISLPVILMDETLK; TVEEVLGHFGVNESTGLSLEQVK 1 IPI00219078.5
667 S_Total95_3219 IPI00177817.4 |SWISS-PROT:P16615-2 |REFSEQ_NP:NP_001672 |ENSEMBL:ENSP00000311186 Tax_Id=9606 Splice Isoform SERCA2A of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 13 VDQSILTGESVSVIK; SLPSVETLGCTSVICSDK; TASEMVLADDNFSTIVAAVEEGR; IAVALAVAAIPEGLPAVITTCLALGTRRMAK; VGEATETALTCLVEK; TGTLTTNQMSVCR; EFDELNPSAQR; IGIFGQDEDVTSK; DIVPGDIVEIAVGDK; EWGSGSDTLR; ISLPVILMDETLK; TVEEVLGHFGVNESTGLSLEQVK; FVARNYLEPAILE 1 IPI00177817.4
668 S_Total95_3260 IPI00514090.1 |SWISS-PROT:P09960-2 Tax_Id=9606 Splice Isoform 2 of Leukotriene A-4 hydrolase 13 EDDLNSFNATDLK; DLSSHQLNEFLAQTLQR; LVVDLTDIDPDVAYSSVPYEK; TLTGTAALTVQSQEDNLR; HFNALGGWGELQNSVK; SSALQWLTPEQTSGK; DGETPDPEDPSR; LTYTAEVSVPK; PEIVDTCSLASPASVCR; GSPMEISLPIALSK; SAYEFSETESMLK; SLSNVIAHEISHSWTGNLVTNK; AILPCQDTPSVK 1 IPI00514090.1
669 S_Total95_3547 IPI00418408.1 |TREMBL:Q6XP50 |REFSEQ_NP:NP_001002910 Tax_Id=9606 Cytochrome P450 13 AVSNVIASLTCGR; VQQEIDDVIGQVR; DEAVWEKPFR; DIEVQGFR; RFSVSTLR; GTTLITNLSSVLK; LLDLAQEGLK; LLDLAQEGLKEESGFLR; AFLTQLDELLTEHR; FGDIVPLGVTHMTSR; YPPGPLPLPGLGNLLHVDFQNTPYCFDQLR; VVSFLVTPSPYELCAVPR; EESGFLREVLNAVPVLPHIPALAGKVLR 1 IPI00418408.1
670 S_Total95_3900 IPI00007676.1 |TREMBL:Q9Y6G8; Q53GQ0; Q96EA9; Q96JU2 |REFSEQ_NP:NP_057226 |ENSEMBL:ENSP00000278353 |H-INV:HIT000035857; HIT000011154; HIT000035615 Tax_Id=9606 Steroid dehydrogenase homolog 13 ISYSLFTALR; TFVDFFSQCLHEEYR; SKGVFVQSVLPYFVATK; TIAVDFASEDIYDKIK; TIAVDFASEDIYDK; DKLDQVSSEIK; VETRTIAVDFASEDIYDKIK; GVFVQSVLPYFVATK; MININILSVCK; KPTLDKPSPETFVK; LDQVSSEIK; VWGVGNEAGVGPGLGEWAVVTGSTDGIGK; SKGAILNISSGSGMLPVPLLTIYSATK 1 IPI00007676.1
671 S_Total95_4211 IPI00329352.3 |SWISS-PROT:Q15155 |TREMBL:Q9H049 |REFSEQ_NP:NP_055102 |ENSEMBL:ENSP00000287667 |H-INV:HIT000026462 Tax_Id=9606 Nodal modulator 1 precursor 13 AEDDQPLPGVLLSLSGGLFR; DGENYVVLLDSTLPR; HITLIFNPTR; ITFDVAPSR; LDFTVEHDSLK; SSIDSEPALVLGPLK; IQSTVTQPGGK; EQQLAEIEAR; VLNGPEGDGVPEAVVTLNNQIK; GQPLGPAGVQVSLR; SENLDNPIQTVSLGQSLFFHFPPLLR; PMMDVAFVQFLASVSGK; VLGQAASDNSGPEDAK 1 IPI00329352.3
672 S_Total95_4212 IPI00305461.2 |SWISS-PROT:P19823 |TREMBL:Q5T986; Q5T985 |REFSEQ_NP:NP_002207 |ENSEMBL:ENSP00000351190 Tax_Id=9606 Inter-alpha-trypsin inhibitor heavy chain H2 precursor 13 AEDHFSVIDFNQNIR; IQPSGGTNINEALLR; FYNQVSTPLLR; VVNNSPQPQNVVFDVQIPK; TEVNVLPGAK; NICFNIDSEPGK; AHVSFKPTVAQQR; IYGNQDTSSQLK; VQFELHYQEVK; ETAVDGELVVLYDVK; NVQFNYPHTSVTDVTQNNFHNYFGGSEIVVAGK; AEDHFSVIDFNQNIRTWRNDLISATK; FLHVPDTFEGHFDGVPVISK 1 IPI00305461.2
673 S_Total95_4665 IPI00220741.2 |SWISS-PROT:P02549 |TREMBL:O60686; Q5VYL2; Q5VYL1 |REFSEQ_NP:NP_003117 |ENSEMBL:ENSP00000295798 Tax_Id=9606 Spectrin, alpha, erythrocytic 1 (elliptocytoSiS 2) 13 ETGTLESQLEANK; HQSLEAEVQTKSR; LSESHPDATEDLQR; SSDEIENAFQALAEGK; TAAINADELPTDVAGGEVLLDR; VTILGETAER; VLETAEEIQER; GYVSLEDYTAFLIDKESENIK; DLNTLAEDLLSSGTFNVDQIVK; LADDEDYKDIQNLK; DLQGVQNLLK; LSEVASLWEELLEATK; NQANACQQQQAAPVEGVAGEQR 1 IPI00220741.2
674 S_Total95_4727 IPI00300371.3 |SWISS-PROT:Q15393 |TREMBL:Q9UFX7; Q9BPY2; Q6NTI8 |REFSEQ_NP:NP_036558 |ENSEMBL:ENSP00000305790 |H-INV:HIT000031464; HIT000003771; HIT000029648; HIT000024515 Tax_Id=9606 Splicing factor 3B subunit 3 13 FGNICVVR; FLAVGLVDNTVR; LGAVFNQVAFPLQYTPR; TVLDPVTGDLSDTR; WVTTASLLDYDTVAGADK; HIANYISGIQTIGHR; LPPNTNDEVDEDPTGNK; NFGDQPDIR; TPVEEVPAAIAPFQGR; RIVPGQFLAVDPKGR; ELAAEMAAAFLNENLPESIFGAPK; FSNTGEDWYVLVGVAK; MQGQEAVLAMSSR 1 IPI00300371.3
675 S_Total95_5258 IPI00396057.1 |REFSEQ_NP:NP_055427 |ENSEMBL:ENSP00000277165 Tax_Id=9606 C9orf10 protein 13 LLVDADNCLHR; NQAAIQGRPPYAASAEEVAK; AEGSSTASSGSQLAEGK; NIQDTSDLDAIAK; SQGGVQPIPSQGGK; QTAQQIVSHVQNK; TPLIDLCDGQADQAAK; SPQTPELVEALAFR; RQELDAFLAQALSPK; GTPPPKVWFLPPVCMAHCIRLALIR; PGPFGMPGMVPPHVPPQMLNIPQTSLQAK; QSHTLPFPPPPALPFYPASAYPR; TCNTNPHLNALSTDSACR 1 IPI00396057.1
676 S_Total95_5799 IPI00099730.1 |TREMBL:Q9UQ37; Q9UQ39; Q6PIM3; Q9UQ35; Q6NSL3; Q9UQ38; Q8IW17; Q9UHA8; Q9UQ36; Q6PK40; Q96GY7; O15038; O60382; O94803; Q9UQ40 |REFSEQ_NP:NP_057417 |ENSEMBL:ENSP00000301740 |H-INV:HIT000000030; HIT000009177; HIT000008853 Tax_Id=9606 RNA binding protein 13 SSTGPEPPAPTPLLAER; SSTPPGESYFGVSSLQLK; TPQAPASANLVGPR; SEEPAGQILSHLSSELK; TAAALAPASLTSAR; SLSYSPVER; IPAASAAAMNLASAR; MAPALSGANLTSPR; SAHATAPVNIAGSR; SASGSSSDRSRSATPPATR; TPAIPTAVNLADSR; RPNPDILDHER; PAVTETHQLAELNEK 1 IPI00099730.1
677 S_Total95_6409 IPI00020513.1 |SWISS-PROT:Q15942 |TREMBL:Q6I9S4; Q96AF9; Q28617 |REFSEQ_NP:NP_001010972; NP_003452 |ENSEMBL:ENSP00000324422 |H-INV:HIT000034751; HIT000033938; HIT000034307 Tax_Id=9606 Zyxin 13 FSPGAPGGSGSQPNQK; VSSIDLEIDSLSSLLDDMTK; PAAGGTAPLPPWK; SSTKPAAGGTAPLPPWK; GPPASSPAPAPK; QHPVPPPAQNQNQVR; LGHPEALSAGTGSPQPPSFTYAQQR; PQVQLHVQSQTQPVSLANTQPR; SPSSSQPLPQVPAPAQSQTQFHVQPQPQPK; FGPVVAPK; VNPFRPGDSEPPPAPGAQR; PGDSEPPPAPGAQR; PSPAISVSVSAPAFYAPQK 1 IPI00020513.1
678 S_Total95_7782 IPI00221106.5 |SWISS-PROT:Q13435 |TREMBL:Q7L4T5; Q9BWD2; Q96CM6; Q7Z627 |REFSEQ_NP:NP_006833 |ENSEMBL:ENSP00000318861 |H-INV:HIT000033330 Tax_Id=9606 Splicing factor 3B Subunit 2 13 SSLGQSASETEEDTVSVSK; VGEPVALSEEER; LENSAAPKK; PGDLSDELRISLGMPVGPNAHK; EDFSDMVAEHAAK; IEEAMDGSETPQLFTVLPEK; LAEIGAPIQGNR; PLYGDVFGTNAAEFQTK; FTVAELKQLVAR; GIEKPPFELPDFIK; YGPPPSYPNLK; RGIEKPPFELPDFIK; QEEMNSQQEEEEMETDAR 1 IPI00221106.5
679 S_Total95_2 IPI00014424.1 |SWISS-PROT:Q05639 |REFSEQ_NP:NP_001949 |ENSEMBL:ENSP00000217182 |H-INV:HIT000029618 Tax_Id=9606 Elongation factor 1-alpha 2 12 EHALLAYTLGVK; IGGIGTVPVGR; LPLQDVYK; QLIVGVNK; NMITGTSQADCAVLIVAAGVGEFEAGISK; NGQTREHALLAYTLGVK; QTVAVGVIK; THINIVVIGHVDSGK; STTTGHLIYK; PMCVESFSQYPPLGR; THINIVVIGHVDSGKSTTTGHLIYK; Comb 1 IPI00014424.1
680 S_Total95_23 IPI00020956.1 |SWISS-PROT:P51858 |TREMBL:Q5SZ09 |REFSEQ_NP:NP_004485 |ENSEMBL:ENSP00000349878; ENSP00000305393 |H-INV:HIT000038497 Tax_Id=9606 Hepatoma-derived growth factor 12 GFSEGLWEIENNPTVK; GPPQEEEEEEDEEEEATK; KGFSEGLWEIENNPTVK; SCVEEPEPEPEAAEGDGDKK; YQVFFFGTHETAFLGPK; SCVEEPEPEPEAAEGDGDK; EAATLEVERPLPMEVEK; GPPQEEEEEEDEEEEATKEDAEAPGIR; KSCVEEPEPEPEAAEGDGDKK; CGDLVFAK; IDEMPEAAVK; Comb; PMF 1 IPI00020956.1
681 S_Total95_26 IPI00550041.1 |TREMBL:Q8WVX0 |H-INV:HIT000037995 Tax_Id=9606 ECH1 protein 12 EVDVGLAADVGTLQR; YCAQDAFFQVK; YQETFNVIER; VIGNQSLVNELAFTAR; HVLHVQLNRPNK; MFTAGIDLMDMASDILQPK; MMADEALGSGLVSR; VNLLYSR; EVMLDAALALAAEISSK; VFPDKEVMLDAALALAAEISSK; PVIAAVHGGCIGGGVDLVTACDIR; PMF; Comb 1 IPI00550041.1
682 S_Total95_57 IPI00554521.1 |SWISS-PROT:P02794 |TREMBL:Q6NZ44 |REFSEQ_NP:NP_002023 |ENSEMBL:ENSP00000301775 |H-INV:HIT000037419; HIT000020754; HIT000030381; HIT000011430; HIT000037446; HIT000035216; HIT000036334; HIT000037724; HIT000029959 Tax_Id=9606 Ferritin heavy chain 12 NVNQSLLELHK; MGAPESGLAEYLFDK; ELGDHVTNLR; KMGAPESGLAEYLFDK; NDPHLCDFIETHYLNEQVK; QNYHQDSEAAINR; IFLQDIK; YFLHQSHEER; KPDCDDWESGLNAMECALHLEK; LATDKNDPHLCDFIETHYLNEQVK; AIKELGDHVTNLR; PMF; Comb 2 IPI00419501.4, IPI00554521.1
683 S_Total95_100 IPI00339269.1 |SWISS-PROT:P17066 |TREMBL:Q5QNY2; Q53FC7 |REFSEQ_NP:NP_002146 |ENSEMBL:ENSP00000310219 |H-INV:HIT000018786 Tax_Id=9606 Heat shock 70 kDa protein 6 12 VEIIANDQGNR; VEILANDQGNR; TTPSYVAFTDTER; FEELCSDLFR; IINEPTAAAIAYGLDR; ATAGDTHLGGEDFDNR; DAGAIAGLNVLR; LLQDFFNGK; MKETAEAYLGQPVK; ETAEAYLGQPVKHAVITVPAYFNDSQR; GVPQIEVTFDIDANGILSVTATDR; Comb 1 IPI00339269.1
684 S_Total95_236 IPI00549385.1 |TREMBL:Q96DG6 |REFSEQ_NP:NP_620164 |ENSEMBL:ENSP00000296658 |H-INV:HIT000030498 Tax_Id=9606 Similar to mouse 2310016A09Rik protein 12 DSEDIYNLK; NLIEWLNK; DVSLLTQK; LEYGGLGR; AGVSVYGIVK; AVIVIQDIFGWQLPNTR; EDCSPADKPYIDEAR; NPTLFIFAENDVVIPLK; RNLIEWLNK; TFSGQTHGFVHR; REDCSPADKPYIDEAR; Comb; PMF 2 IPI00383046.1, IPI00549385.1
685 S_Total95_330 IPI00550584.1 |H-INV:HIT000022199 Tax_Id=9606 Ig alpha-1 chain C region 12 DASGVTFTWTPSSGK; WLQGSQELPR; TFTCTAAYPESK; TPLTATLSK; QEPSQGTTTFAVTSILR; NFPPSQDASGDLYTTSSQLTLPATQCLAGK; SGNTFRPEVHLLPPPSEELALNELVTLTCLAR; KGDTFSCMVGHEALPLAFTQK; DLCGCYSVSSVLPGCAEPWNHGK; GFSPKDVLVR; VTVSSASPTSPK; Comb 1 IPI00550584.1
686 S_Total95_333 IPI00549485.1 |H-INV:HIT000021883 Tax_Id=9606 Ig alpha-1 chain C region 12 DASGVTFTWTPSSGK; WLQGSQELPR; TFTCTAAYPESK; TPLTATLSK; QEPSQGTTTFAVTSILR; NFPPSQDASGDLYTTSSQLTLPATQCLAGK; SGNTFRPEVHLLPPPSEELALNELVTLTCLAR; KGDTFSCMVGHEALPLAFTQK; DLCGCYSVSSVLPGCAEPWNHGK; GFSPKDVLVR; QAPGQGPEWMGIMSPSGDRITYSQKFR; Comb 1 IPI00549485.1
687 S_Total95_362 IPI00293564.5 |SWISS-PROT:P35914 |TREMBL:Q5QPQ6; Q6IBC0 |REFSEQ_NP:NP_000182 |ENSEMBL:ENSP00000235958 |H-INV:HIT000035002 Tax_Id=9606 Hydroxymethylglutaryl-CoA lyase, mitochondrial precursor 12 GFEAAVAAGAK; EVVIFGAASELFTK; FPGINYPVLTPNLK; GYVSCALGCPYEGK; NINCSIEESFQR; AAQSANISVR; KNINCSIEESFQR; EVVIFGAASELFTKK; LIDMLSEAGLSVIETTSFVSPK; FYSMGCYEISLGDTIGVGTPGIMK; LLEAGNFICQALNR; PMF; Comb 1 IPI00293564.5
688 S_Total95_390 IPI00454722.1 |REFSEQ_XP:XP_497846 Tax_Id=9606 PREDICTED: similar to Phosphatidylethanolamine-binding protein (PEBP) (Prostatic binding protein) (HCNPpp) (Neuropolypeptide h3) (Raf kinase inhibitor protein) (RKIP) 12 EWHHFLVVNMK; LYTLVLTDPDAPSR; YVWLVYEQDR; CDEPILSNR; LYTLVLTDPDAPSRK; YVWLVYEQDRPLK; YREWHHFLVVNMK; NRPTSIXWDGLDSGK; GNDISSDTLLSDYVGSGPPK; YVWLVYEQDRPLKCDEPILSNR; VLTPTQVK; Comb 1 IPI00454722.1
689 S_Total95_402 IPI00017672.2 |SWISS-PROT:P00491 |TREMBL:Q8N7G1; Q9P1G4; Q5PZ03 |REFSEQ_NP:NP_000261 |ENSEMBL:ENSP00000354532 |H-INV:HIT000023374 Tax_Id=9606 Hypothetical protein FLJ25678 12 VFGFSLITNK; VIMDYESLEK; DHINLPGFSGQNPLR; FEVGDIMLIR; FPAMSDAYDR; HRPQVAIICGSGLGGLTDK; LEQFVSILMASIPLPDK; LGADAVGMSTVPEVIVAR; VFHLLGVDTLVVTNAAGGLNPK; LTQAQIFDYGEIPNFPR; NTAEWLLSHTK; PMF; Comb 1 IPI00017672.2
690 S_Total95_433 IPI00005969.1 |SWISS-PROT:P52907 |TREMBL:Q6FHD5; Q53FQ6 |REFSEQ_NP:NP_006126 |ENSEMBL:ENSP00000263168 |H-INV:HIT000029380 Tax_Id=9606 F-actin capping protein alpha-1 subunit 12 DVQDSLTVSNEAQTAK; LLLNNDNLLR; TIDGQQTIIACIESHQFQPK; FTITPPTAQVVGVLK; IEGYEDQVLITEHGDLGNSR; DHYSNGFCTVYAK; EASDPQPEEADGGLK; KEASDPQPEEADGGLK; FITHAPPGEFNEVFNDVR; IIENAENEYQTAISENYQTMSDTTFK; IQVHYYEDGNVQLVSHK; PMF; Comb 1 IPI00005969.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home