Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
691 S_Total95_504 IPI00382894.2 |TREMBL:Q8TCG3; Q5VU58 Tax_Id=9606 Tropomyosin 3 12 IQLVEEELDR; EDKYEEEIK; LEEAEKAADESER; RIQLVEEELDR; IQVLQQQADDAEER; MEIQEIQLK; KLVIIEGDLER; KIQVLQQQADDAEER; LVIIEGDLER; TIDDLEDELYAQK; EQAEAEVASLNR; PMF; Comb 1 IPI00382894.2
692 S_Total95_509 IPI00216975.1 |SWISS-PROT:P67936-2 |ENSEMBL:ENSP00000345230 |H-INV:HIT000006659 Tax_Id=9606 Splice Isoform 2 of Tropomyosin alpha 4 chain 12 IQLVEEELDR; EDKYEEEIK; KLVILEGELER; LEEAEKAADESER; LVILEGELER; RIQLVEEELDR; CGDLEEELKNVTNNLK; EENVGLHQTLDQTLNELNCI; CGDLEEELK; YSEKEDKYEEEIK; ASDAEGDVAALNR; PMF; Comb 1 IPI00216975.1
693 S_Total95_512 IPI00377005.1 |ENSEMBL:ENSP00000328952 Tax_Id=9606 29 kDa protein 12 IQLVEEELDR; EDKYEEEIK; RIQLVEEELDR; IQVLQQQADDAEER; TIDDLEDKLK; MEIQEIQLK; MLDQTLIDLNEM; KIQVLQQQADDAEER; EQAEAEVASLNR; QAEAEVASLNRR; KQAEAEVASLNR; PMF; Comb 1 IPI00377005.1
694 S_Total95_515 IPI00296039.7 |SWISS-PROT:P09493-4 |TREMBL:Q8TCG4 |REFSEQ_NP:NP_000357 |ENSEMBL:ENSP00000288398 |H-INV:HIT000033219 Tax_Id=9606 Splice Isoform 4 of Tropomyosin 1 alpha chain 12 IQLVEEELDR; LEEAEKAADESER; RIQLVEEELDR; MEIQEIQLK; ATDAEADVASLNR; KATDAEADVASLNR; QLEDELVSLQK; GTEDELDKYSEALK; KLVIIESDLER; SIDDLEDELYAQK; AELSEGQVR; PMF; Comb 1 IPI00296039.7
695 S_Total95_521 IPI00220739.2 |SWISS-PROT:O00264 |TREMBL:Q6IB11 |REFSEQ_NP:NP_006658 |ENSEMBL:ENSP00000217971 |H-INV:HIT000042079 Tax_Id=9606 Membrane associated progesterone receptor component 1 12 FYGPEGPYGVFAGR; GLATFCLDK; EGEEPTVYSDEEEPK; EGEEPTVYSDEEEPKDESAR; GDQPAASGDSDDDEPPPLPR; KFYGPEGPYGVFAGR; FDGVQDPR; RDFTPAELR; DEYDDLSDLTAAQQETLSDWESQFTFK; EALKDEYDDLSDLTAAQQETLSDWESQFTFK; GRKFYGPEGPYGVFAGR; PMF; Comb 1 IPI00220739.2
696 S_Total95_598 IPI00298547.3 |SWISS-PROT:Q99497 |REFSEQ_NP:NP_009193 |ENSEMBL:ENSP00000340278; ENSP00000234912 |H-INV:HIT000033663 Tax_Id=9606 DJ-1 protein 12 DVVICPDASLEDAK; DGLILTSR; GAEEMETVIPVDVMR; DVVICPDASLEDAKK; EGPYDVVVLPGGNLGAQNLSESAAVK; GLIAAICAGPTALLAHEIGFGSK; GPGTSFEFALAIVEALNGK; VTVAGLAGKDPVQCSR; MMNGGHYTYSENR; KEGPYDVVVLPGGNLGAQNLSESAAVK; KGLIAAICAGPTALLAHEIGFGSK; PMF; Comb 1 IPI00298547.3
697 S_Total95_629 IPI00293088.4 |SWISS-PROT:P10253 |TREMBL:Q8IWE7 |REFSEQ_NP:NP_000143 |ENSEMBL:ENSP00000305692; ENSP00000346310 Tax_Id=9606 Lysosomal alpha-glucosidase precursor 12 PLFLEFPK; AGYIIPLQGPGLTTTESR; APSPLYSVEFSEEPFGVIVR; GAYTQVIFLAR; VTSEGAGLQLQK; WGYSSTAITR; GELFWDDGESLEVLER; LDVMMETENR; AHFPLDVQWNDLDYMDSR; NHNSLLSLPQEPYSFSEPAQQAMR; DFPAMVQELHQGGR; Comb; PMF 1 IPI00293088.4
698 S_Total95_635 IPI00553164.2 |SWISS-PROT:P08865 |TREMBL:Q86VC0; Q6NSD1; Q6IPD2; Q6NXQ8 |REFSEQ_NP:NP_001012321; NP_002286 |ENSEMBL:ENSP00000346067 |H-INV:HIT000034927; HIT000032434; HIT000012605; HIT000034034; HIT000036377 Tax_Id=9606 Ribosomal protein SA, 67kDa 12 FAAATGATPIAGR; YVDIAIPCNNK; SDGIYIINLK; ADHQPLTEASYVNLPTIALCNTDSPLR; AIVAIENPADVSVISSR; DPEEIEKEEQAAAEK; FTPGTFTNQIQAAFR; KSDGIYIINLK; KSDGIYIINLKR; LLVVTDPR; FLAAGTHLGGTNLDFQMEQYIYK; Comb; PMF 1 IPI00553164.2
699 S_Total95_644 IPI00465184.2 |SWISS-PROT:Q9Y2T3 |TREMBL:Q5SZC4; Q5SZC7; Q9ULG2; Q9H335; Q5SZC6; Q5SZC3 |REFSEQ_NP:NP_004284 |ENSEMBL:ENSP00000351170; ENSP00000238018 |H-INV:HIT000022394; HIT000000974 Tax_Id=9606 Guanine deaminase 12 NIEEVYVGGK; EFDAILINPK; NYTSVYDK; FQNIDFAEEVYTR; NYTSVYDKNNLLTNK; ASDSPIDLFYGDFFGDISEAVIQK; FLYLGDDR; LATLGGSQALGLDGEIGNFEVGK; VCMDLNDTFPEYK; GASIAHCPNSNLSLSSGFLNVLEVLK; TVMAHGCYLSAEELNVFHER; Comb; PMF 1 IPI00465184.2
700 S_Total95_645 IPI00106642.4 |SWISS-PROT:Q9HCN8 |TREMBL:Q86U75; Q9NR93 |REFSEQ_NP:NP_071327 |ENSEMBL:ENSP00000248958 |H-INV:HIT000032702 Tax_Id=9606 Dihydropyrimidinase-like 2 12 QIGENLIVPGGVK; MSVIWDKAVVTGK; FQLTDCQIYEVLSVIR; AITIANQTNCPLYITK; FQMPDQGMTSADDFFQGTK; GIQEEMEALVK; KKGTVVYGEPITASLGTDGSHYWSK; TGAELVTCGSVLK; YGSGSGQQSVTGVEASDDANSYWR; PSVEPSAGHDEL; GQHEVHGMPSANTHNTWK; FQHVGTSVFLSVTGEQYGSPIR 1 IPI00106642.4
701 S_Total95_651 IPI00293975.3 |SWISS-PROT:P07203 |TREMBL:Q6NSD4 |REFSEQ_NP:NP_000572 |ENSEMBL:ENSP00000347453 Tax_Id=9606 Glutathione peroxidase 1 isoform 1 12 NDVAWNFEK; NEEILNSLK; EALPAPSDDATALMTDPK; FLVGPDGVPLRR; GLVVLGFPCNQFGHQENAK; PLAGGEPVSLGSLR; RFQTIDIEPDIEALLSQGPSCA; FLVGPDGVPLR; LITWSPVCR; FQTIDIEPDIEALLSQGPSCA; DYTQMNELQR; Comb 1 IPI00293975.3
702 S_Total95_665 IPI00024911.1 |SWISS-PROT:P30040 |TREMBL:Q6FHT4 |REFSEQ_NP:NP_006808 |ENSEMBL:ENSP00000261735 Tax_Id=9606 Endoplasmic reticulum protein ERp29 precursor 12 GALPLDTVTFYK; SLNILTAFQK; ESYPVFYLFR; DGDFENPVPYTGAVK; FDTQYPYGEK; ILDQGEDFPASEMTR; LAENSASSDDLLVAEVGISDYGDK; YKLDKESYPVFYLFR; WAEQYLK; GQGVYLGMPGCLPVYDALAGEFIR; LDKESYPVFYLFR; PMF; Comb 1 IPI00024911.1
703 S_Total95_690 IPI00553131.2 |SWISS-PROT:Q14376 |TREMBL:Q5QPP3; Q5QPP1; Q5QPP2 |REFSEQ_NP:NP_000394; NP_001008217 |ENSEMBL:ENSP00000313026 |H-INV:HIT000030279 Tax_Id=9606 UDP-glucose 4-epimerase 12 DYIHVVDLAK; AVGESVQKPLDYYR; VNLTGTIQLLEIMK; EALNVFGNDYDTEDGTGVR; IYNLGTGTGYSVLQMVQAMEK; TWNAVLLR; GGGSLPESLR; SVEFEEMDILDQGALQR; VLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFR; EGDVAACYANPSLAQEELGWTAALGLDR; REGDVAACYANPSLAQEELGWTAALGLDR; PMF; Comb 1 IPI00553131.2
704 S_Total95_762 IPI00017819.1 |TREMBL:Q14032; Q96L31 |REFSEQ_NP:NP_001692 |ENSEMBL:ENSP00000259407 |H-INV:HIT000034438 Tax_Id=9606 Bile acid CoA: Amino acid N-acyltransferase 12 KHLIPDVTSQL; WYVAPGVTR; KPEVTDLEYFEEAANFLLR; DVMNRPFQVQVK; GFASLALAYHNYEDLPR; HLIPDVTSQL; LYDLELIVNNK; AHAEQAIGQLK; ASLTLERWYVAPGVTRIK; GALFLPPGEGLFPGVIDLFGGLGGLLEFR; MIQLTATPVSALVDEPVHIR; AHAEQAIGQLKR 1 IPI00017819.1
705 S_Total95_769 IPI00017469.1 |SWISS-PROT:P35270 |TREMBL:Q93041; Q53GI9; Q9UBB1; Q9UEC5 |REFSEQ_NP:NP_003115 |ENSEMBL:ENSP00000234454 |H-INV:HIT000037938 Tax_Id=9606 Sepiapterin reductase 12 SGAHVDFYDK; VPADLGAEAGLQQLLGALR; LLSLLEKDEFK; LLLINNAGSLGDVSK; TVVNISSLCALQPFK; AVCLLTGASR; TLAPLLASLLSPGSVLVLSAR; VLNYAPGPLDTDMQQLAR; VVRVPADLGAEAGLQQLLGALR; LLSILEK; AFPDSPGLNR; PMF; Comb 1 IPI00017469.1
706 S_Total95_829 IPI00010706.1 |SWISS-PROT:P48637 |TREMBL:Q8TDA8 |REFSEQ_NP:NP_000169 |ENSEMBL:ENSP00000216951 |H-INV:HIT000033538 Tax_Id=9606 Glutathione synthetase 12 AIENELLAR; ALAEGVLLR; AWELYGSPNALVLLIAQEK; CPDIATQLAGTK; EGIAQTVFLGLNR; AIEHADGGVAAGVAVLDNPYPV; QYSLQNWEAR; EGGGNNLYGEEMVQALK; PGMLEMLLPGQPEAVAR; KVQQELSRPGMLEMLLPGQPEAVAR; ATFAGLYSLDVGEEGDQAIAEALAAPSR; PMF; Comb 1 IPI00010706.1
707 S_Total95_832 IPI00018398.4 |SWISS-PROT:P17980 |TREMBL:Q53HU5; Q6IBS1; Q6GPG8 |REFSEQ_NP:NP_002795 |ENSEMBL:ENSP00000298852 Tax_Id=9606 26S protease regulatory subunit 6A 12 PGDLVGVNK; VDILDPALLR; DSYLILETLPTEYDSR; QTYFLPVIGLVDAEK; FENLGIQPPK; AMEVDERPTEQYSDIGGLDK; APSIIFIDELDAIGTK; GVLMYGPPGTGK; MNVSPDVNYEELAR; TMLELLNQLDGFQPNTQVK; TLPYLVSNVIELLDVDPNDQEEDGANIDLDSQR; PMF; Comb 1 IPI00018398.4
708 S_Total95_874 IPI00016862.1 |SWISS-PROT:P00390 |TREMBL:Q03504 |REFSEQ_NP:NP_000628 |ENSEMBL:ENSP00000221130 Tax_Id=9606 Glutathione reductase, mitochondrial precursor 12 ALLTPVAIAAGR; GHAAFTSDPKPTIEVSGK; LGGTCVNVGCVPK; LNAIYQNNLTK; TYSTSFTPMYHAVTK; ADFDNTVAIHPTSSEELVTLR; GIYAVGDVCGK; ALLTPVAIAAGRKLAHR; GIYAVGDVCGKALLTPVAIAAGR; GHIIVDEFQNTNVK; LDYNNIPTVVFSHPPIGTVGLTEDEAIHK; PMF 1 IPI00016862.1
709 S_Total95_930 IPI00024317.1 |SWISS-PROT:Q92947-1 |REFSEQ_NP:NP_000150 |ENSEMBL:ENSP00000222214 |H-INV:HIT000023200; HIT000031007 Tax_Id=9606 Splice Isoform Long of Glutaryl-CoA dehydrogenase, mitochondrial precursor 12 AITGIQAFTASK; GYGCAGVSSVAYGLLAR; EIISEMGELGVLGPTIK; YGIAWGVLGASEFCLHTAR; SSRPEFDWQDPLVLEEQLTTDEILIR; TWITNSPMADLFVVWAR; AAPEMVSLLK; GELLGCFGLTEPNSGSDPSSMETR; DMLGGNGISDEYHVIR; HAMNLEAVNTYEGTHDIHALILGR; SAMSVQSSLVMHPIYAYGSEEQR; PMF; Comb 1 IPI00024317.1
710 S_Total95_961 IPI00465256.3 |SWISS-PROT:Q9UIJ7 |TREMBL:Q5VYW6 |REFSEQ_NP:NP_057366 |ENSEMBL:ENSP00000276892 |H-INV:HIT000004425; HIT000004027 Tax_Id=9606 GTP:AMP phosphotransferase mitochondrial 12 KGVLETFSGTETNK; VYNIEFNPPK; AYQIDTVINLNVPFEVIK; GVLETFSGTETNK; NLTQYSWLLDGFPR; TVGIDDLTGEPLIQR; AYEDQTKPVLEYYQK; IWPYVYAFLQTK; TLPQAEALDR; HLSSGDLLR; AVIMGAPGSGK; PMF; Comb 1 IPI00465256.3
711 S_Total95_1037 IPI00299000.1 |SWISS-PROT:Q9UQ80 |TREMBL:Q13548; Q6PIN5; Q9UM59 |REFSEQ_NP:NP_006182 |ENSEMBL:ENSP00000302886 |H-INV:HIT000033300; HIT000030777 Tax_Id=9606 Proliferation-associated protein 2G4 12 AAHLCAEAALR; TAENATSGETLEENEAGD; TIIQNPTDQQK; SDQDYILK; EGEFVAQFK; AEFEVHEVYAVDVLVSSGEGK; HELLQPFNVLYEK; QHVIDGEKTIIQNPTDQQKK; SEMEVQDAELK; ITSGPFEPDLYK; LVKPGNQNTQVTEAWNK; Comb; PMF 1 IPI00299000.1
712 S_Total95_1056 IPI00303882.1 |SWISS-PROT:O60664-1 |TREMBL:Q9BS03; Q53G77 |REFSEQ_NP:NP_005808 |ENSEMBL:ENSP00000221957 |H-INV:HIT000033305; HIT000030502 Tax_Id=9606 Splice Isoform B of Mannose-6-phosphate receptor binding protein 1 12 LEPQIASASEYAHR; TLTAAAVSGAQPILSK; DIAQQLQATCTSLGSSIQGLPTNVK; QLQGPEKEPPK; DTVATQLSEAVDATR; IATSLDGFDVASVQQQR; LEENLPILQQPTEK; SVVTGGVQSVMGSR; QLQGPEKEPPKPEQVESR; SEEWADNHLPLTDAELAR; EALDHMVEYVAQNTPVTWLVGPFAPGITEK; Comb; PMF 1 IPI00303882.1
713 S_Total95_1090 IPI00444329.1 |TREMBL:Q6ZSA3 Tax_Id=9606 Hypothetical protein FLJ45695 12 HYLLSQGWWDEEQEK; HFVTISSPLATQIPQAVGAAYAAK; QGQIINPSEDPHLPK; VDGNDVFAVYNATK; AVAENQPFLIEAMTYR; LEFIQPNVISGIPIYR; NNGYAISTPTSEQYR; VMEAFEQAER; HLQTYGEHYPLDHFDK; KPKPNPNLLFSDVYQEMPAQLR; ERHFVTISSPLATQIPQAVGAAYAAK; Comb; PMF 1 IPI00444329.1
714 S_Total95_1170 IPI00022334.1 |SWISS-PROT:P04181 |TREMBL:Q59HE2; Q6IAV9; Q68CS0 |REFSEQ_NP:NP_000265 |ENSEMBL:ENSP00000224242 |H-INV:HIT000030031; HIT000037753 Tax_Id=9606 Ornithine aminotransferase, mitochondrial precursor 12 AFYNNVLGEYEEYITK; WLAVDYENVRPDIVLLGK; EDELRESIEIINK; TVQGPPTSDDIFER; VAIAALEVLEEENLAENADK; GIYLWDVEGR; LPSDVVTAVR; IVFAAGNFWGR; VLPMNTGVEAGETACK; YGAHNYHPLPVALER; KYFDFLSSYSAVNQGHCHPK; PMF; Comb 1 IPI00022334.1
715 S_Total95_1180 IPI00171834.3 |TREMBL:Q6NW33 |H-INV:HIT000030975 Tax_Id=9606 KRT19 protein 12 IVLQIDNAR; LAADDFR; LASYLDK; LEQEIATYR; VLDELTLAR; LASYLDKVR; SRLEQEIATYR; DYSHYYTTIQDLR; ILGATIENSR; AALEDTLAETEAR; EELAYLKKNHEEEISTLR; Comb; PMF 1 IPI00171834.3
716 S_Total95_1184 IPI00005087.1 |SWISS-PROT:Q9NYL9 |TREMBL:Q5HYL6 |REFSEQ_NP:NP_055362 |ENSEMBL:ENSP00000308753 |H-INV:HIT000025831; HIT000038810 Tax_Id=9606 Tropomodulin-3 12 DREDYVPYTGEK; FGYQFTKQGPR; DLDEDELLGNLSETELK; DNETLAELK; ILPVFDEPPNPTNVEESLK; ILPVFDEPPNPTNVEESLKR; QLETVLDDLDPENALLPAGFR; ENDAHLVEVNLNNIK; MLEENTNILK; YKDLDEDELLGNLSETELK; SNDPVATAFAEMLK; Comb; PMF 1 IPI00005087.1
717 S_Total95_1256 IPI00003527.4 |SWISS-PROT:O14745 |REFSEQ_NP:NP_004243 |ENSEMBL:ENSP00000262613 |H-INV:HIT000035445; HIT000030419; HIT000009855; HIT000031516 Tax_Id=9606 Ezrin-radixin-moesin binding phosphoprotein 50 12 SVDPDSPAEASGLR; EALAEAALESPRPALVR; LLVVDPETDEQLQK; EALAEAALESPR; LVEVNGENVEK; GPNGYGFHLHGEK; AQEAPGQAEPPAAAEVQGAGNENEPR; SASSDTSEELNSQDSPPK; KGPSGYGFNLHSDK; LGVQVREELLRAQEAPGQAEPPAAAEVQGAGNENEPR; QDSTAPSSTSSSDPILDFNISLAMAK; PMF; Comb 1 IPI00003527.4
718 S_Total95_1274 IPI00001960.2 |SWISS-PROT:Q9Y696 |TREMBL:Q5VSX5; Q9NVF8 |REFSEQ_NP:NP_039234 |ENSEMBL:ENSP00000306292 |H-INV:HIT000004098; HIT000024586; HIT000035817 Tax_Id=9606 Chloride intracellular channel protein 4 12 NSRPEANEALER; AGSDGESIGNCPFSQR; DEFTNTCPSDKEVEIAYSDVAK; IEEFLEEVLCPPK; DEFTNTCPSDK; HPESNTAGMDIFAK; EEDKEPLIELFVK; EVEIAYSDVAK; FLDGNEMTLADCNLLPK; LDEYLNSPLPDEIDENSMEDIK; KPADLQNLAPGTHPPFITFNSEVK; Comb; PMF 1 IPI00001960.2
719 S_Total95_1279 IPI00304435.3 |SWISS-PROT:Q9BPW8 |REFSEQ_NP:NP_003625 |ENSEMBL:ENSP00000216121 |H-INV:HIT000032858; HIT000030838; HIT000023197 Tax_Id=9606 NipSnap1 protein 12 GWDENVYYTVPLVR; IQFHNVKPEYLDAYNSLTEAVLPK; LKPGTMIEWGNNWAR; MGPNIYELR; DNEGSWFR; NQLLLEFSFWNEPQPR; FSGGYPALMDCMNK; DAHSTLLSKKETSNLYK; PGTMIEWGNNWAR; LKNNKEYLEFR; LHLDEDYPCSLVGNWNTWYGEQDQAVHLWR; Comb; PMF 1 IPI00304435.3
720 S_Total95_1289 IPI00410729.2 |SWISS-PROT:Q9BY49-1 |TREMBL:Q53TC4 |REFSEQ_NP:NP_060911 |ENSEMBL:ENSP00000265322 |H-INV:HIT000030967; HIT000002278 Tax_Id=9606 Splice Isoform 1 of Peroxisomal trans-2-enoyl-CoA reductase 12 AGFPLAVHSGAAR; SLALEWACSGIR; AGVYNLTK; SLYTHSYEVPDHDNWPK; EHGGSIVNIIVPTK; IGVPEEVSSVVCFLLSPAASFITGQSVDVDGGR; NEEEVNNLVK; SAADELQANLPPTK; SYLAPGLLQGQVAIVTGGATGIGK; ELLELGTNVVIASRKLER; INFLVNNGGGQFLSPAEHISSK; Comb 1 IPI00410729.2
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home