Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
721 S_Total95_1353 IPI00008475.1 |SWISS-PROT:Q01581 |TREMBL:Q8N995; Q5XJ04 |REFSEQ_NP:NP_002121 |ENSEMBL:ENSP00000322706 |H-INV:HIT000020347 Tax_Id=9606 Hydroxymethylglutaryl-CoA synthase, cytoplasmic 12 LEVGTETIIDK; LEDTYFDRDVEK; PTGGVGAVALLIGPNAPLIFER; NNLSYDCIGR; ITASLCDLK; LPATAAEPEAAVISNGEH; NSIYSGLEAFGDVK; NNLSYDCIGRLEVGTETIIDK; MLLNDFLNDQNR; VTQDATPGSALDK; RPTPNDDTLDEGVGLVHSNIATEHIPSPAK; PMF; Comb 1 IPI00008475.1
722 S_Total95_1441 IPI00021727.1 |SWISS-PROT:P04003 |TREMBL:Q5VVQ8 |REFSEQ_NP:NP_000706 |ENSEMBL:ENSP00000264304 |H-INV:HIT000039462 Tax_Id=9606 C4b-binding protein alpha chain precursor 12 LSLEIEQLELQR; EDVYVVGTVLR; FSAICQGDGTWSPR; WTPYQGCEALCCPEPK; CEWETPEGCEQVLTGK; YTCLPGYVR; GVGWSHPLPQCEIVK; LMQCLPNPEDVK; TPSCGDICNFPPK; CHPGYKPTTDEPTTVICQK; KPDVSHGEMVSGFGPIYNYK; Comb 1 IPI00021727.1
723 S_Total95_1463 IPI00012074.2 |SWISS-PROT:O43390 |TREMBL:Q7Z334; Q9BV64; Q6MZS5; Q5TEH1 |REFSEQ_NP:NP_005817 |ENSEMBL:ENSP00000304405 |H-INV:HIT000023410; HIT000030422 Tax_Id=9606 HNRPR protein 12 AGPIWDLR; HIGVCISVANNR; GFCFLEYEDHK; NLATTVTEEILEK; DLYEDELVPLFEK; TGYTLDVTTGQR; TKENILEEFSK; EIEGEEIEIVLAKPPDK; SAFLCGVMK; YGGPPPDSVYSGVQPGIGTEVFVGK; LMMDPLSGQNRGYAFITFCGKEAAQEAVK; Comb 1 IPI00012074.2
724 S_Total95_1540 IPI00554737.1 |SWISS-PROT:P30153 Tax_Id=9606 Serine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, alpha isoform 12 IGPILDNSTLQSEVKPILEK; LNIISNLDCVNEVIGIR; QLSQSLLPAIVELAEDAK; DCEAEVRAAASHK; EFCENLSADCR; TSACGLFSVCYPR; LSTIALALGVER; LTQDQDVDVK; SALASVIMGLSPILGK; DNTIEHLLPLFLAQLK; AISHEHSPSDLEAHFVPLVK; PMF; Comb 1 IPI00554737.1
725 S_Total95_1643 IPI00016342.1 |SWISS-PROT:P51149 |REFSEQ_NP:NP_004628 |ENSEMBL:ENSP00000265062 |H-INV:HIT000003301; HIT000033922; HIT000036337 Tax_Id=9606 Ras-related protein Rab-7 12 DEFLIQASPR; EAINVEQAFQTIAR; VIILGDSGVGK; NNIPYFETSAK; DPENFPFVVLGNK; GADCCVLVFDVTAPNTFK; ATIGADFLTK; QETEVELYNEFPEPIK; FQSLGVAFYR; LVTMQIWDTAGQER; TSLMNQYVNK; Comb; PMF 1 IPI00016342.1
726 S_Total95_1658 IPI00514587.1 |TREMBL:Q5T5C7 Tax_Id=9606 Seryl-tRNA synthetase 12 ELVSCSNCTDYQAR; IEQFVYSSPHDNK; TICAILENYQTEK; YLIATSEQPIAALHR; MVLDLDLFRVDK; LDLEAWFPGSGAFR; EVMQEVAQLSQFDEELYK; DEWLRPEDLPIK; FKDPGLVDQLVK; KEPVGDDESVPENVLSFDDLTADALANLK; EPVGDDESVPENVLSFDDLTADALANLK; Comb; PMF 1 IPI00514587.1
727 S_Total95_1716 IPI00221325.2 |SWISS-PROT:P49792 Tax_Id=9606 Ran-binding protein 2 12 VTEEENKGSGTGAAGASDTTIK; GVIFGQTSSTFTFADLAK; KTFEECQQNLMKLQK; QNQTTAISTPASSEISK; QNQTTSAVSTPASSETSK; EPELEDLTRYDVGAIR; VWLWTACDFADGER; YIASVQGSTPSPR; FKTPEEAALFKCK; ELVGPPLAETVFTPK; AEDIENDALSPEEQEECKNYLR; Comb 2 IPI00221325.2, IPI00604429.1
728 S_Total95_1830 IPI00006091.1 |SWISS-PROT:P11532-1 Tax_Id=9606 Splice Isoform 4 of Dystrophin 12 ILADLEEENR; LRQLLEQPQAEAK; SEVEMVIKTGRQIVQK; QEESLKNIKDSLQQSSGR; SLEGSDDAVLLQR; EKVNAIEREK; GLSPLPSPPEMMPTSPQSPR; AWTELTDWLSLLDQVIK; IDETLERLQELQEATDELDLKLR; QAEGLSEDGAAMAVEPTQIQLSKR; VSEREAALEETHRLLQQFPLDLEK; Comb 2 IPI00006091.1, IPI00304639.1
729 S_Total95_2036 IPI00450768.4 |SWISS-PROT:Q04695 |TREMBL:Q6IP98; Q14666 |REFSEQ_NP:NP_000413 |ENSEMBL:ENSP00000319235 |H-INV:HIT000035527 Tax_Id=9606 Keratin, type I cytoskeletal 17 12 LAADDFR; LASYLDK; LEQEIATYR; VLDELTLAR; TRLEQEIATYR; LASYLDKVR; EVATNSELVQSGK; ASLEGNLAETENR; DAEDWFFSK; ALEEANTELEVK; ILTATVDNANILLQIDNAR; PMF 2 IPI00550909.2, IPI00450768.4
730 S_Total95_2069 IPI00550368.1 |TREMBL:Q8NFG0 |REFSEQ_NP:NP_056134 |ENSEMBL:ENSP00000319756 Tax_Id=9606 C1 domain-containing phosphatase and tensin-like protein splice variant 2 12 VSAQGITLTDNQR; SPGGHSDGASPRSPVPTTLPGLR; LLGGCGVASGGR; DPLEETPEAPVPTNMSTAADLLR; VTSACQALPPVELR; AGSISPGSPPYPQSR; EVVILEDPGLPALYPCPACEEK; NDPSVSVDYNTTEPAVR; HLPGPGQQPGPWGPEQASSPAR; AGEEGHEGCSYTMCPEGR; DAPCSASSELSGPSTPLHTSSPVQGK; PMF 2 IPI00550368.1, IPI00465295.2
731 S_Total95_2308 IPI00479404.1 |TREMBL:Q709C5; Q5THJ4 |REFSEQ_NP:NP_056193 |ENSEMBL:ENSP00000011700 Tax_Id=9606 VPS13D-1A protein 12 IQDFNDEK; YPGAVLSGNLPDLK; IEGKFVNPVQVVLAK; EEMCRIEEEQSFEELK; NKFLFAGFPGTFSLQDK; YFNKLKGGLLSTDDK; IEEEQSFEELK; SATSVSLDKILTK; NSSSESAIVPKTVK; LETPMELRLDSPSAPDK; GQGTANPEGYISTLPGSSVVFHWPR; PMF 2 IPI00400836.2, IPI00479404.1
732 S_Total95_2363 IPI00176377.5 |REFSEQ_XP:XP_007651 Tax_Id=9606 PREDICTED: similar to Sorbitol dehydrogenase (L-iditol 2-dehydrogenase) 12 ALEAFETFK; AMGAAQVVVTDLSATR; EIGADLVLQISK; KPMVLGHEASGTVEK; ALEAFETFKK; IGNFIVK; SGGTLVLVGLGSEMTTVPLLHAAIR; YCNTWPVAISMLASK; SVNVKPLVTHR; MHSVGICGSDVHYWEYGR; PRNLSALAAQIPVPLR; KPMVLGHEASGTVEKVGSSVGK 1 IPI00176377.5
733 S_Total95_2449 IPI00549304.1 |H-INV:HIT000022217 Tax_Id=9606 Ig gamma-1 chain C region 12 NQVSLTCLVK; EPQVYTLPPSR; STSGGTAALGCLVK; GPSVFPLAPSSK; FNWYVDGVEVHNAK; TPEVTCVVVDVSHEDPEVK; THTCPPCPAPELLGGPSVFLFPPKPK; THTCPPCPAPELLGGPSVFLFPPK; EPQVYTLPPSRDELTK; GFYPSDIAVEWESNGQPENNYK; TTPPVLDSDGSFFLYSK; WQQGNVFSCSVMHEALHDHYTQK 1 IPI00549304.1
734 S_Total95_2452 IPI00472610.2 |SWISS-PROT:P01857 |TREMBL:Q6PI81; Q6PJA4 |H-INV:HIT000038436 Tax_Id=9606 IGHM protein 12 NQVSLTCLVK; EPQVYTLPPSR; STSGGTAALGCLVK; VVSVLTVLHQDWLNGK; GPSVFPLAPSSK; FNWYVDGVEVHNAK; TPEVTCVVVDVSHEDPEVK; THTCPPCPAPELLGGPSVFLFPPKPK; THTCPPCPAPELLGGPSVFLFPPK; GFYPSDIAVEWESNGQPENNYK; TTPPVLDSDGSFFLYSK; GTTVTVSSASTK 1 IPI00472610.2
735 S_Total95_2477 IPI00171494.3 |TREMBL:Q16693; Q7Z363; Q6ZUM6; Q6ZMX7; Q9HAE4; Q8NCM8; Q8N977 |REFSEQ_XP:XP_370652 |ENSEMBL:ENSP00000334021 |H-INV:HIT000020434; HIT000001712; HIT000005092 Tax_Id=9606 PREDICTED: dynein, cytoplasmic, heavy polypeptide 2 12 YVVQIGDK; TCLEEWTKSAGLEK; GEHLSPDHWLDLFR; LVLYLKDINLPKLDK; DAYLPLAESASK; RLEEVLAIR; DQIEVMKGNVKSR; MGLGGNPYGPAGTGKTESVK; QFFNSSVIDVFNQRNK; GTTLLSSEVQKLASALLNQK; CYLTLTQAMKMGLGGNPYGPAGTGKTESVK; AQETIKAAEVLINQLDREHK 1 IPI00171494.3
736 S_Total95_2498 IPI00022891.2 |SWISS-PROT:P12235 |REFSEQ_NP:NP_001142 |ENSEMBL:ENSP00000281456 |H-INV:HIT000033884 Tax_Id=9606 ADP,ATP carrier protein, heart/skeletal muscle isoform T1 12 GLYQGFNVSVQGIIIYR; YFPTQALNFAFK; EQGFLSFWR; YFAGNLASGGAAGATSLCFVYPLDFAR; EFHGLGDCIIK; AAYFGVYDTAK; GNLANVIR; LLLQVQHASK; DFLAGGVAAAVSK; GAWSNVLR; GMGGAFVLVLYDEIK; GMGGAFVLVLYDEIKK 1 IPI00022891.2
737 S_Total95_2506 IPI00455628.1 |REFSEQ_XP:XP_496711 Tax_Id=9606 PREDICTED: similar to elongation factor 1 alpha 12 EHALLAYTLGVK; QLIVGVNK; NGQTREHALLAYTLGVK; QTVAVGVIK; YYVTIIDAPGHR; DGNASGTTLLEALDCILPPTRPTDK; DGNASGTTLLEALDCILPPTR; STTTGHLIYK; KDGNASGTTLLEALDCILPPTR; KDGNASGTTLLEALDCILPPTRPTDK; SGDAAIVDMVPGK; THINTVIIGHVDSGK 1 IPI00455628.1
738 S_Total95_2559 IPI00018146.1 |SWISS-PROT:P27348 |TREMBL:Q53RR5; Q567U5; Q53S41 |REFSEQ_NP:NP_006817 |ENSEMBL:ENSP00000238081 Tax_Id=9606 14-3-3 protein tau 12 AVTEQGAELSNEER; DSTLIMQLLR; YLIANATNPESK; VISSIEQK; KQTIDNSQGAYQEAFDISK; SICTTVLELLDK; QTIDNSQGAYQEAFDISK; TAFDEAIAELDTLNEDSYK; YLAEVACGDDRK; NLLSVAYK; YLAEVACGDDR; QTIDNSQGAYQEAFDISKK 1 IPI00018146.1
739 S_Total95_2567 IPI00382844.1 |TREMBL:O75944 Tax_Id=9606 Aconitase 12 DGYAQILR; SQFTITPGSEQIR; LQLLEPFDK; DLEDLQILIK; GHLDNISNNLLIGAINIENGK; NAVTQEFGPVPDTAR; WVVIGDENYGEGSSR; IHPVDKLTIQGLK; EGWPLDIR; WDGKDLEDLQILIK; VGLIGSCTNSSYEDMGR; FNPETDFLTGKDGK 1 IPI00382844.1
740 S_Total95_2608 IPI00065063.1 |SWISS-PROT:Q96LJ7 |REFSEQ_NP:NP_612461 |ENSEMBL:ENSP00000288111 |H-INV:HIT000028790; HIT000014765; HIT000036493; HIT000037416 Tax_Id=9606 Dehydrogenase/reductase SDR family member 1 12 EEVLQDPVLK; GHYFCSVYGAR; SAFSSAETTELSGK; WIIALYTSK; AFWETPASMWDDINNVGLR; GIALQLCK; HGVSCVSLWPGIVQTELLK; LAADCAHELR; LDVLVNNAYAGVQTILNTR; SLFEQVDR; VVAQEAQSLGGQCVPVVCDSSQESEVR; CVVALATDPNILSLSGK 1 IPI00065063.1
741 S_Total95_2715 IPI00009747.1 |SWISS-PROT:P48449 |REFSEQ_NP:NP_002331; NP_001001438 |ENSEMBL:ENSP00000324649; ENSP00000348762 Tax_Id=9606 Lanosterol synthase 12 NPDGGFATYETK; LSQVPDNPPDYQK; LSAAEDPLVQSLR; LYEHIVADDR; QTWTYLQDER; STVFGTALNYVSLR; SVQLPDGGWGLHIEDK; EQTGLEAYALGLDTK; ETLTQGLEFCR; FSQLYPER; SCAISYTSYR; IPDYLWMGLDGMK 1 IPI00009747.1
742 S_Total95_2721 IPI00294159.3 |SWISS-PROT:P53007 |TREMBL:Q6LAP8 |REFSEQ_NP:NP_005975 |ENSEMBL:ENSP00000215882 |H-INV:HIT000032129; HIT000033620 Tax_Id=9606 Tricarboxylate transport protein, mitochondrial precursor 12 SHGVLGLYR; NTWDCGLQILK; GLSSLLYGSIPK; GTYQGLTATVLK; TQLQLDER; AILAGGLAGGIEICITFPTEYVK; FIHDQTSPNPK; FGMFEFLSNHMR; FFVMTSLR; GLLCGLGAGVAEAVVVVCPMETIK; VCLDVAIVFVIYDEVVK; GDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIK 1 IPI00294159.3
743 S_Total95_2735 IPI00412198.1 |ENSEMBL:ENSP00000343582 Tax_Id=9606 31 kDa protein 12 TPAQYDASELK; TNQELQEINR; DIISDTSGDFR; SALSGHLETVILGLLK; TDLEKDIISDTSGDFR; DIISDTSGDFRK; GLGTDEDSLIEIICSR; KGTDVPKWISIMTER; SLYYYIQQDTK; QDIAFAYQR; SYSPYDMLESIR; IGVDEVTIVNILTNR 1 IPI00412198.1
744 S_Total95_2739 IPI00513929.1 |TREMBL:Q5SX86 Tax_Id=9606 GDP dissociation inhibitor 2 12 DWNVDLIPK; DWNVDLIPKFLMANGQLVK; MLLYTEVTR; GRDWNVDLIPK; FLVYVANFDEKDPR; VPSTEAEALASSLMGLFEK; VTEGSFVYK; TFEGIDPK; FDLGQDVIDFTGHALAL; FLVYVANFDEK; IPGSPPESMGR; KFDLGQDVIDFTGHALAL 1 IPI00513929.1
745 S_Total95_2744 IPI00550089.3 |SWISS-PROT:P04899 |TREMBL:Q93020 |REFSEQ_NP:NP_002061 |ENSEMBL:ENSP00000312999 |H-INV:HIT000035686 Tax_Id=9606 Guanine nucleotide-binding protein G(i), alpha-2 subunit 12 YDEAASYIQSK; EYQLNDSAAYYLNDLER; ILLLGAGESGK; AVVYSNTIQSIMAIVK; EIYTHFTCATDTK; IAQSDYIPTQQDVLR; ITHSPLTICFPEYTGANK; TTGIVETHFTFK; LFDSICNNK; NVQFVFDAVTDVIIK; AMGNLQIDFADPSR; IIHEDGYSEEECR 1 IPI00550089.3
746 S_Total95_2771 IPI00426542.1 |SWISS-PROT:O60656 |TREMBL:Q53E75; Q5DSZ5 |REFSEQ_NP:NP_066307 |ENSEMBL:ENSP00000346768 Tax_Id=9606 UDP-glucuronosyltransferase 1-9 precursor, microsomal 12 AMAIADALGK; GAGVTLNVLEMTSEDLENALK; IPQTVLWR; WLPQNDLLGHPMTR; ESSFDAVFLDPFDNCGLIVAK; YFSLPSVVFAR; ILLGFSDAMTFK; NALEIASEILQTPVTEYDLYSHTSIWLLR; GILCHYLEEGAQCPAPLSYVPR; NHIMHLEEHLLCHR; TYSTSYTLEDLDR; TYSTSYTLEDLDREFK 1 IPI00426542.1
747 S_Total95_2776 IPI00026530.4 |SWISS-PROT:P49257 |TREMBL:Q53FS4 |REFSEQ_NP:NP_005561 |ENSEMBL:ENSP00000251047 |H-INV:HIT000041494 Tax_Id=9606 ERGIC-53 protein precursor 12 DIDNLVQR; GPHLVQSDGTVPFWAHAGNAIPSSDQIR; YQEEFEHFQQELDK; GDGVGGDPAVALPHR; RYVSSLTEEISK; YVSSLTEEISKR; GHPDLQGQPAEEIFESVGDR; YVSSLTEEISK; AAFENWEVEVTFR; QLDMILDEQR; NNPAIVIIGNNGQIHYDHQNDGASQALASCQR; LVSGMQHPGSAGGVYETTQHFIDIK 1 IPI00026530.4
748 S_Total95_2818 IPI00409717.1 |SWISS-PROT:Q14240-2 |H-INV:HIT000035864 Tax_Id=9606 Splice Isoform 2 of Eukaryotic initiation factor 4A-II 12 GYDVIAQAQSGTGK; GIYAYGFEKPSAIQQR; MFVLDEADEMLSR; RKVDWLTEK; LQAEAPHIVVGTPGR; VLITTDLLAR; GIDVQQVSLVINYDLPTNR; DFTVSALHGDMDQK; DIETFYNTTVEEMPMNVADLI; KGVAINFVTEEDKR; ETQALVLAPTR; EHGGPEGMDPDGVIESNWNEIVDNFDDMNLK 2 IPI00409717.1, IPI00328328.3
749 S_Total95_2872 IPI00299573.9 |SWISS-PROT:P62424 |TREMBL:Q5T8U4; Q5T8U2; Q9BY74 |REFSEQ_NP:NP_000963 |ENSEMBL:ENSP00000340366; ENSP00000346018 |H-INV:HIT000032232 Tax_Id=9606 60S ribosomal protein L7a 12 NFGIGQDIQPK; VAPAPAVVK; AGVNTVTTLVENKK; TCTTVAFTQVNSEDKGALAK; VPPAINQFTQALDR; AGVNTVTTLVENK; KMGVPYCIIKGK; TCTTVAFTQVNSEDK; MGVPYCIIKGKAR; HWGGNVLGPK; RLKVPPAINQFTQALDR; AQLVVIAHDVDPIELVVFLPALCR 2 IPI00604554.1, IPI00299573.9
750 S_Total95_3193 IPI00031812.1 |SWISS-PROT:P67809 |TREMBL:Q6PKI6; Q5FVF0 |REFSEQ_NP:NP_004550 |ENSEMBL:ENSP00000163282 |H-INV:HIT000037054; HIT000030872; HIT000034938 Tax_Id=9606 Nuclease sensitive element binding protein 1 12 NDTKEDVFVHQTAIK; NYQQNYQNSESGEK; EDVFVHQTAIK; SVGDGETVEFDVVEGEK; NEGSESAPEGQAQQR; EDGNEEDKENQGDETQGQQPPQR; NYQQNYQNSESGEKNEGSESAPEGQAQQR; RPQYSNPPVQGEVMEGADNQGAGEQGR; GAEAANVTGPGGVPVQGSK; AADPPAENSSAPEAEQGGAE; PGTTGSGAGSGGPGGLTSAAPAGGDK; PGTTGSGAGSGGPGGLTSAAPAGGDKK 1 IPI00031812.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home