Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
751 S_Total95_3354 IPI00384828.1 |TREMBL:O60593 Tax_Id=9606 Arg/Abl-interacting protein ArgBP2b 12 AQPARPPPPAQPGEIGEAIAK; VGIFPISYVEK; YNFNADTNVELSLR; KGDTVYILR; QGIFPVSYVEVVK; SFTSSSPSSPSR; APHYPGIGPVDESGIPTAIR; PMSSASMASDFR; QGIFPVSYVEVVKKNTK; VDLPGSSTTLTK; LGEVTGSPSPPPR; SSILQHERPPPLPTTPTPVPR 1 IPI00384828.1
752 S_Total95_3414 IPI00550364.3 |TREMBL:Q53FP5; Q5QTR0; Q9NV22 |REFSEQ_NP:NP_060760 |ENSEMBL:ENSP00000307059 |H-INV:HIT000004319 Tax_Id=9606 Phosphoglucomutase 2 variant 12 ELNELVSAIEEHFFQPQK; LDQETAQWLR; NSLTLEAVKR; WDKNSLTLEAVKR; DLTTGYDDSQPDK; DLTTGYDDSQPDKK; IVLANDPDADR; DGVSAAVISAELASFLATK; DPDPEFPTVK; DTYMLSSTVSSK; YYAELCAPPGNSDPEQLK; YYAELCAPPGNSDPEQLKK 3 IPI00300265.5, IPI00549837.2, IPI00550364.3
753 S_Total95_3606 IPI00026216.4 |SWISS-PROT:P55786 |REFSEQ_NP:NP_006301 |ENSEMBL:ENSP00000320324 |H-INV:HIT000021564 Tax_Id=9606 Puromycin-sensitive aminopeptidase 12 VLGATLLPDLIQK; AGIISTVEVLK; DAESIHQYLLQR; YQGGFLISR; KPYPDDENLVEVK; LGLQNDLFSLAR; TIQQCCENILLNAAWLK; VTLSFPSTLQTGTGTLK; YAAVTQFEATDAR; SPVYLTVLK; NAATEDLWESLENASGK; AFPCWDEPAIKATFDISLVVPK 1 IPI00026216.4
754 S_Total95_3703 IPI00033036.1 |SWISS-PROT:P50579 |REFSEQ_NP:NP_006829 |ENSEMBL:ENSP00000325312 |H-INV:HIT000036364 Tax_Id=9606 Methionine aminopeptidase 2 12 DEDDEDGDGDGDGATGKK; SALEDKERDEDDEDGDGDGDGATGK; ALDQASEEIWNDFR; HLLNVINENFGTLAFCR; NLCDLGIVDPYPPLCDIK; GQECEYPPTQDGR; EEGAASTAEEAAK; LCDVGEAIQEVMESYEVEIDGK; MEEGEVYAIETFGSTGK; GPSAAGEQEPDKESGASVDEVAR; SKGPSAAGEQEPDKESGASVDEVAR; ERDEDDEDGDGDGDGATGKK 1 IPI00033036.1
755 S_Total95_3739 IPI00298971.1 |SWISS-PROT:P04004 |REFSEQ_NP:NP_000629 |ENSEMBL:ENSP00000226218 |H-INV:HIT000032180 Tax_Id=9606 Vitronectin precursor 12 DVWGIEGPIDAAFTR; FEDGVLDPDYPR; SIAQYWLGCPAPGHL; VDTVDPPYPR; GQYCYELDEK; GDVFTMPEDEYTVYDDGEEK; PFDAFTDLK; DWHGVPGQVDAAMAGR; MDWLVPATCEPIQSVFFFSGDK; CQCDELCSYYQSCCTDYTAECKPQVTR; GNPEQTPVLKPEEEAPAPEVGASKPEGIDSR; PETLHPGRPQPPAEEELCSGK 1 IPI00298971.1
756 S_Total95_3762 IPI00025307.1 |SWISS-PROT:Q02318 |REFSEQ_NP:NP_000775 |ENSEMBL:ENSP00000258415 Tax_Id=9606 Cytochrome P450 27, mitochondrial precursor 12 EIEVDGFLFPK; DPTAFSEPESFQPHR; VGLQFLQR; YLDGWNAIFSFGK; NTQFVFCHYVVSR; QRSLEEIPR; ATGAPGAGPGVR; WTRPVLPFWK; IQHPFGSVPFGYGVR; VVLAPETGELK; DPEIQEALHEEVVGVVPAGQVPQHK; LLKPAEAALYTDAFNEVIDDFMTR 1 IPI00025307.1
757 S_Total95_3778 IPI00386755.2 |SWISS-PROT:Q96HE7 |REFSEQ_NP:NP_055399 |ENSEMBL:ENSP00000352044 |H-INV:HIT000036048 Tax_Id=9606 ERO1-like protein alpha precursor 12 FDGILTEGEGPR; QEIVSLFNAFGR; YSEEANNLIEECEQAER; DCAVKPCQSDEVPDGIK; IWNVIYEENCFKPQTIK; VLPFFERPDFQLFTGNK; RPCPFWNDISQCGR; LGAVDESLSEETQK; MLLLEILHEIK; HDDSSDNFCEADDIQSPEAEYVDLLLNPER; RDCAVKPCQSDEVPDGIK; RPLNPLASGQGTSEENTFYSWLEGLCVEK 1 IPI00386755.2
758 S_Total95_3787 IPI00022744.5 |SWISS-PROT:P55060-1 |REFSEQ_NP:NP_001307 |ENSEMBL:ENSP00000262982 |H-INV:HIT000023448 Tax_Id=9606 Splice Isoform 1 of Importin-alpha re-exporter 12 FLESVEGNQNYPLLLLTLLEK; IVEDEPNKICEADR; IIIPEIQKVSGNVEK; LLQTDDEEEAGLLELLK; YGALALQEIFDGIQPK; NLFEDQNTLTSICEK; SQICDNAALYAQK; TGNIPALVR; LVLDAFALPLTNLFK; IPGLLGVFQK; AADEEAFEDNSEEYIR; HGITQANELVNLTEFFVNHILPDLK 2 IPI00022744.5, IPI00219994.2
759 S_Total95_3904 IPI00011285.1 |SWISS-PROT:P07384 |TREMBL:Q6DHV4 |REFSEQ_NP:NP_005177 |ENSEMBL:ENSP00000279247 |H-INV:HIT000037870; HIT000033946 Tax_Id=9606 Calpain-1 catalytic subunit 12 KAPSDLYQIILK; LDETDDPDDYGDR; LEICNLTPDALK; YSEPDLAVDFDNFVCCLVR; CLQSGTLFR; NYPATFWVNPQFK; SEQFINLR; WNTTLYEGTWR; YLGQDYEQLR; IRLDETDDPDDYGDR; LYELIITR; LPPGEYVVVPSTFEPNKEGDFVLR 1 IPI00011285.1
760 S_Total95_3945 IPI00100496.4 |SWISS-PROT:Q9H4A4 |TREMBL:Q7RU04 |REFSEQ_NP:NP_064601 |ENSEMBL:ENSP00000295640 |H-INV:HIT000009918; HIT000022226; HIT000035706; HIT000030114 Tax_Id=9606 Aminopeptidase B 12 LGDTYPSISNAR; AEFGPPGPGAGSR; EEYNGVIEEFLATGEK; LDSHPCLEVTAAALR; TYQLVYFLDKILQK; VGEGPGVCWLAPEQTAGK; VKIEPGVDPDDTYNETPYEK; SILADDFLDFYLEYFPELK; LFGPYVWGR; IEPGVDPDDTYNETPYEK; ETFASTASQLHSNVVNYVQQIVAPK; KKPFVYTQGQAVLNR 1 IPI00100496.4
761 S_Total95_4078 IPI00215637.3 |SWISS-PROT:O00571 |TREMBL:Q5S4N1; Q5JSI3; Q59GX6 |REFSEQ_NP:NP_076829; NP_001347 |ENSEMBL:ENSP00000310870; ENSP00000244357 |H-INV:HIT000035471 Tax_Id=9606 DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3 12 SFLLDLLNATGK; TAAFLLPILSQIYSDGPGEALR; GKIGLDFCK; HAIPIIK; LEQELFSGGNTGINFEK; SPILVATAVAAR; VGNLGLATSFFNER; VGSTSENITQK; DFLDEYIFLAVGR; IVEQDTMPPK; MLDMGFEPQIR; VRPCVVYGGADIGQQIR 1 IPI00215637.3
762 S_Total95_4110 IPI00437593.1 |TREMBL:Q6RZ40 Tax_Id=9606 Type XVIII collagen long variant 12 TEAPSATGQASSLLGGR; GADFQCFQQAR; AVGLAGTFR; LTESYCETWR; LQDLYSIVR; DFQPVLHLVALNSPLSGGMR; ADDILASPPR; GLELEPGAGLFVAQAGGADPDK; LTFIDMEGSGFGGDLEALR; PGPPGLPGNQGPPGPK; GTDNEVAALQPPVVQLHDSNPYPR; HAAPSAFSSGLPGALSQVAVTTLTK 1 IPI00437593.1
763 S_Total95_4224 IPI00396015.3 |TREMBL:Q7Z561 |REFSEQ_NP:NP_942131 |ENSEMBL:ENSP00000344789 Tax_Id=9606 Acetyl-Coenzyme A cArboxylAse AlphA isoform 1 12 FGAYIVDGLR; EASFEYLQNEGER; DFTVASPAEFVTR; FVVMVTPEDLK; ITSENPDEGFKPSSGTVQELNFR; RIPVQAVWAGWGHASENPK; IPVQAVWAGWGHASENPK; IGSFGPQEDLLFLR; ILNVPQELYEK; TVELSIPADPANLDSEAK; DPTLTDELLNILTELTQLSK; TDCNHIFLNFVPTVIMDPSK 4 IPI00472339.1, IPI00396018.1, IPI00396017.3, IPI00396015.3
764 S_Total95_4231 IPI00550769.3 |TREMBL:Q9H6K9; Q96K06; Q53GM8 |REFSEQ_NP:NP_073609 |ENSEMBL:ENSP00000320828 |H-INV:HIT000011037; HIT000009098; HIT000019394 Tax_Id=9606 Epidermal growth factor receptor pathway substrate 8-like protein 2 variant 12 AFLEKQQSGSELEELMNKFHSMNQR; LLDIESQEELEDFPLPTVQR; SQPVSQPLTYESGPDEVR; SVSCPLLSR; DELMQHMDEVNDELIRK; VGPQVPLSEPGFR; QQSGSELEELMNK; AVLAQKIEK; DEVLEVLEDGR; ILYDFTAR; SGQAGYVPCNILGEARPEDAGAPFEQAGQK; FHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSR 1 IPI00550769.3
765 S_Total95_4348 IPI00556217.1 |TREMBL:Q59HB9 Tax_Id=9606 Fibrillin 1 variant 12 CECPVGFFYNDK; CPTGYYLNEDTR; LLVCEDIDECQNGPVCQR; CLCPEGFSLSSSGR; TCVDINECLLEPR; GEGWGDPCELCPTEPDEAFR; CICPPGYSLQNEK; MCCCSYNIGR; TNDDQTMCLDINECER; RPDGEGCVDENECQTKPGICENGR; ILCPGGEGFRPNPITVILEDIDECQELPGLCQGGK; NAAVTEGEAGVPL 1 IPI00556217.1
766 S_Total95_4458 IPI00396421.2 |TREMBL:Q8N765; O94874 |REFSEQ_NP:NP_056138 |ENSEMBL:ENSP00000343666 |H-INV:HIT000000501 Tax_Id=9606 Hypothetical protein KIAA0776 12 DLQEEVSNLYNNIR; TYDLPGNFLTQALTQR; FINDCTELFR; IPEDQHALLVKYQGLVVK; FFADDTQAALTK; ATEGSGSMRGGGGGNAR; YGFQEQLLYSVLEELVNSGR; NNPVHLITEEDLK; SIEDFISCLDSAAEACDIMVK; TQSTWVDSFFR; GLFSAITRPTAVNSLISK; TGQGDYPLNNELDKEQEDVASTTR 1 IPI00396421.2
767 S_Total95_4487 IPI00478233.1 |ENSEMBL:ENSP00000354648 |H-INV:HIT000026549; HIT000002715; HIT000000364 Tax_Id=9606 Similar to Kinesin-like protein GAKIN 12 DSVLTWLLK; SLTTLGLVISALADQSAGK; VTLQIPASSLDANR; FSFHSPSAQQRLRQWAEER; TGAAGDRLKEGSNINK; TVAATNMNEESSR; LSLVDLAGSERATKTGAAGDR; TAMVATVSPAADNYDETLSTLR; MAANVENPASADSEAYIEK; WESQQDVSQTTVSR; YVGPADFQEGTWVGVELDLPSGK; GIAPAPALSVSPQNNHSPDPGLSNLAASYLNPVK 2 IPI00479529.1, IPI00478233.1
768 S_Total95_4736 IPI00020210.1 |SWISS-PROT:O75923 |TREMBL:Q7Z6P1; Q8TEL8; Q53TD2; Q53QY3 |REFSEQ_NP:NP_003485 |ENSEMBL:ENSP00000258104 |H-INV:HIT000014884 Tax_Id=9606 Dysferlin 12 FIFPFDYLPAEQVCTIAK; IGETVVDLENRLLSK; WLLLSDPDDFSAGAR; IGETVVDLENR; TQEETEDPSVIGEFK; TSLCVLGPGDEAPLER; IETQNQLLGIADR; GWMIGFEEHKQK; DVILDDLSLTGEK; FSFDDFLGSLQLDLNR; NSVNPVWNEGFEWDLK; KLLSDKPQDFQIR 1 IPI00020210.1
769 S_Total95_4901 IPI00218889.3 |SWISS-PROT:P50570-2 |REFSEQ_NP:NP_004936 |ENSEMBL:ENSP00000352721 Tax_Id=9606 Splice Isoform 2 of Dynamin-2 12 QIELACDSQEDVDSWK; NLVDSYVAIINK; PGPQSVFANSDLFPAPPQIPSR; LQSQLLSIEK; TLNQQLTNHIR; VPVGDQPPDIEYQIK; ESSLILAVTPANMDLANSDALK; LQDAFSSIGQSCHLDLPQIAVVGGQSAGK; CVDLVIQELINTVR; CVDLVIQELINTVRQCTSK; RAIPNQVIR; TGLFTPDLAFEAIVK 1 IPI00218889.3
770 S_Total95_6139 IPI00030131.2 |SWISS-PROT:P42167-1 |ENSEMBL:ENSP00000261210 Tax_Id=9606 Splice Isoform Beta of Lamina-associated polypeptide 2, isoforms beta/gamma 12 SELVANNVTLPAGEQR; YGVNPGPIVGTTR; SSTPLPTISSSAENTR; DDLDVTELTNEDLLDQLVK; DVYVQLYLQHLTAR; GPPDFSSDEER; EPTPVLGSGAAAAGR; QEDKDDLDVTELTNEDLLDQLVK; GPPDFSSDEEREPTPVLGSGAAAAGR; EMFPYEASTPTGISASCR; HASPILPITEFSDIPR; IDGPVISESTPIAETIMASSNESLVVNR 1 IPI00030131.2
771 S_Total95_6140 IPI00216230.2 |SWISS-PROT:P42166 |REFSEQ_NP:NP_003267 |ENSEMBL:ENSP00000266732 Tax_Id=9606 Lamina-associated polypeptide 2 isoform alpha 12 AYEAAASALQIATHTAFVAK; SELVANNVTLPAGEQR; VIEEEWQQVDR; YGVNPGPIVGTTR; SSTPLPTISSSAENTR; PEFLEDPSVLTK; DDLDVTELTNEDLLDQLVK; DVYVQLYLQHLTAR; GPPDFSSDEER; EPTPVLGSGAAAAGR; QEDKDDLDVTELTNEDLLDQLVK; GPPDFSSDEEREPTPVLGSGAAAAGR 1 IPI00216230.2
772 S_Total95_7856 IPI00019848.1 |SWISS-PROT:P51610-1 |REFSEQ_NP:NP_005325 |ENSEMBL:ENSP00000309555 Tax_Id=9606 Splice Isoform 1 of Host cell factor 12 YSNDLYELQASR; MYVFGGWVPLVMDDVK; LGDLWTLDIDTLTWNKPSLSGVAPLPR; TCLPGFPGAPCAIK; FRVAGINACAR; IATGHGQQGVTQVVLK; PAVTTLVVK; SPISVPGGSALISNLGK; VASSPVMVSNPATR; VTGPQATTGTPLVTMR; SPAFVQLAPLSSK; PVQTSAVTGQASTGPVTQIIQTK 2 IPI00019848.1, IPI00219326.1
773 S_Total95_42 IPI00010896.2 |SWISS-PROT:O00299 |TREMBL:Q53FB0; Q502X1; Q5SRT3; Q5SSQ5; Q5SRT6; Q5SRT2 |REFSEQ_NP:NP_001279 |ENSEMBL:ENSP00000211475 Tax_Id=9606 Chloride intracellular channel protein 1 11 NSNPALNDNLEK; LAALNPESNTAGLDIFAK; EEFASTCPDDEEIELAYEQVAK; LHIVQVVCKK; GFTIPEAFR; FLDGNELTLADCNLLPK; VLDNYLTSPLPEEVDETSAEDEGVSQR; GVTFNVTTVDTK; IGNCPFSQR; YLSNAYAR; PMF; Comb 1 IPI00010896.2
774 S_Total95_90 IPI00022426.1 |SWISS-PROT:P02760 |TREMBL:P78491; Q5TBD7; P78492 |REFSEQ_NP:NP_001624 |ENSEMBL:ENSP00000265132 Tax_Id=9606 AMBP protein precursor 11 GVCEETSGAYEK; TVAACNLPIVR; GECVPGEQEPEPILIPR; WYNLAIGSTCPWLK; EYCGVPGDGDEELLR; AVLPQEEEGSGGGQLVTEVTK; CVLFPYGGCQGNGNK; AFIQLWAFDAVK; VVAQGVGIPEDSIFTMADR; ETLLQDFR; Comb; PMF 1 IPI00022426.1
775 S_Total95_106 IPI00025512.2 |SWISS-PROT:P04792 |TREMBL:Q9UC35; Q6FI47; Q96C20 |REFSEQ_NP:NP_001531 |ENSEMBL:ENSP00000248553 |H-INV:HIT000035939; HIT000029692 Tax_Id=9606 Heat-shock protein beta-1 11 LFDQAFGLPR; LATQSNEITIPVTFESR; PLPPAAIESPAVAAPAYSR; LPEEWSQWLGGSSWPGYVR; YTLPPGVDPTQVSSSLSPEGTLTVEAPMPK; AQLGGPEAAK; KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPK; LPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSR; DGVVEITGK; VSLDVNHFAPDELTVK; PMF; Comb 1 IPI00025512.2
776 S_Total95_110 IPI00477037.1 |ENSEMBL:ENSP00000346785 Tax_Id=9606 45 kDa protein 11 LLGPDAAINLTDPDGALAK; WSPIASTLPELVQR; ENLATVEGNFASIDER; LLHEVQELTTEVEK; VHQLYETIQR; VSALDLAVLDQVEAR; YADLPGIAR; LLLQLEATK; LTELETAVR; TGYESGEYEMLGEGLGVK; Comb; PMF 2 IPI00220503.7, IPI00477037.1
777 S_Total95_116 IPI00019755.3 |SWISS-PROT:P78417 |TREMBL:Q5TA03; Q7Z3T2; Q5TA02 |REFSEQ_NP:NP_004823 |ENSEMBL:ENSP00000278062 |H-INV:HIT000029367 Tax_Id=9606 Glutathione transferase omega 1 11 EDPTVSALLTSEK; HEVININLK; DWQGFLELYLQNSPEACDYGL; LNECVDHTPK; GIRHEVININLK; GSAPPGPVPEGSIR; LEEVLTNK; VPSLVGSFIR; EDYAGLKEEFR; SQNKEDYAGLKEEFR; PMF; Comb 1 IPI00019755.3
778 S_Total95_155 IPI00376005.1 |TREMBL:Q53HJ5; Q7Z4L1 |ENSEMBL:ENSP00000336702 Tax_Id=9606 Eukaryotic initiation factor 5A isoform I variant A 11 VHLVGIDIFTGK; EDLRLPEGDLGK; NDFQLIGIQDGYLSLLQDSGEVR; EDLRLPEGDLGKEIEQK; LPEGDLGKEIEQK; YDCGEEILITVLSAMTEEAAVAIK; KYEDICPSTHNMDVPNIK; YEDICPSTHNMDVPNIK; RNDFQLIGIQDGYLSLLQDSGEVR; VHLVGIDIFTGKK; Comb; PMF 1 IPI00376005.1
779 S_Total95_178 IPI00014439.3 |SWISS-PROT:P09417 |TREMBL:Q53F52 |REFSEQ_NP:NP_000311 |ENSEMBL:ENSP00000281243 |H-INV:HIT000029747 Tax_Id=9606 Dihydropteridine reductase 11 TELTPAYF; AALDGTPGMIGYGMAK; GAVHQLCQSLAGK; MTDSFTEQADQVTAEVGK; NRPSSGSLIQVVTTEGR; QSIWTSTISSHLATK; VDAILCVAGGWAGGNAK; EGGLLTLAGAK; NSGMPPGAAAIAVLPVTLDTPMNR; PSSGSLIQVVTTEGR; PMF; Comb 1 IPI00014439.3
780 S_Total95_205 IPI00005038.1 |SWISS-PROT:P52758 |TREMBL:Q6IBG0 |REFSEQ_NP:NP_005827 |ENSEMBL:ENSP00000254878 |H-INV:HIT000035887; HIT000034878 Tax_Id=9606 Ribonuclease UK114 11 IEIEAVAIQGPLTTASL; AAGCDFTNVVK; AAYQVAALPK; APGAIGPYSQAVLVDR; TTVLLADINDFNTVNEIYK; TIYISGQIGMDPSSGQLVSGGVAEEAK; AAGCDFTNVVKTTVLLADINDFNTVNEIYK; QALKNMGEILK; NMGEILK; GSRIEIEAVAIQGPLTTASL; Comb; PMF 1 IPI00005038.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home