Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
781 S_Total95_221 IPI00397808.2 |REFSEQ_XP:XP_371330 |ENSEMBL:ENSP00000355215 Tax_Id=9606 PREDICTED: similar to bA92K2.2 (similar to ubiquitin) 11 ESTLHLVLR; LIFAGKQLEDGR; TLSDYNIQK; IQDKEGIPPDKQR; EGIPPDQQR; ECPSDECGAGVFMASHFDR; TITLEVELSDTIDNVK; CCLTYCFNKPEDK; TLSDYNIQKESTLHLVLR; IQDKEGIPPDQQR; Comb; PMF 1 IPI00397808.2
782 S_Total95_222 IPI00179330.5 |SWISS-PROT:P62979 |TREMBL:Q8WYN9; Q5RKT7 |REFSEQ_NP:NP_002945 |ENSEMBL:ENSP00000272317 |H-INV:HIT000030375 Tax_Id=9606 Ubiquitin and ribosomal protein S27a 11 TITLEVEPSDTIENVK; ESTLHLVLR; LIFAGKQLEDGR; TLSDYNIQK; IQDKEGIPPDKQR; EGIPPDQQR; ECPSDECGAGVFMASHFDR; CCLTYCFNKPEDK; TLSDYNIQKESTLHLVLR; IQDKEGIPPDQQR; Comb; PMF 1 IPI00179330.5
783 S_Total95_253 IPI00419373.1 |SWISS-PROT:P51991-1 |TREMBL:Q53RW7; Q66K53 |REFSEQ_NP:NP_919223 |ENSEMBL:ENSP00000302894 Tax_Id=9606 Splice Isoform 1 of Heterogeneous nuclear ribonucleoprotein A3 11 DYFEKYGK; IETIEVMEDR; EDSVKPGAHLTVK; EDTEEYNLR; LFIGGLSFETTDDSLR; EPEQLRKLFIGGLSFETTDDSLR; IFVGGIKEDTEEYNLR; SSGSPYGGGYGSGGGSGGYGSR; GFAFVTFDDHDTVDK; WGTLTDCVVMR; Comb 2 IPI00455134.1, IPI00419373.1
784 S_Total95_265 IPI00300567.1 |SWISS-PROT:P42126-1 |TREMBL:Q7Z2L7; Q96DC0 |REFSEQ_NP:NP_001910 |ENSEMBL:ENSP00000301729 |H-INV:HIT000034482; HIT000029902; HIT000038634 Tax_Id=9606 Splice Isoform 1 of 3,2-trans-enoyl-CoA isomerase, mitochondrial precursor 11 DADVQNFVSFISK; SPAHYAGYWK; VLVEPDAGAGVAVMK; AVQELWLR; DTLENTIGHR; NPPVNSLSLEFLTELVISLEK; GVILTSDRPGVFSAGLDLTEMCGR; LYQSNLVLVSAINGACPAGGCLVALTCDYR; YCIGLNETQLGIIAPFWLK; SLQMYLER; PMF; Comb 1 IPI00300567.1
785 S_Total95_283 IPI00024989.7 |SWISS-PROT:P22061-2 |TREMBL:Q5VYC1 |H-INV:HIT000033255 Tax_Id=9606 Protein-L-isoaspartate (D-aspartate) O-methyltransferase 11 VFEVMLATDR; SGGASHSELIHNLR; ELVDDSVNNVR; ALDVGSGSGILTACFAR; MKPLMGVIYVPLTDKEK; LILPVGPAGGNQMLEQYDK; MKPLMGVIYVPLTDK; PLMGVIYVPLTDK; MGYAEEAPYDAIHVGAAAPVVPQALIDQLK; MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR; Comb; PMF 1 IPI00024989.7
786 S_Total95_341 IPI00219757.12 |SWISS-PROT:P09211 |TREMBL:Q5TZY3 |REFSEQ_NP:NP_000843 |ENSEMBL:ENSP00000196968 |H-INV:HIT000035116 Tax_Id=9606 Glutathione S-transferase P 11 EEVVTVETWQEGSLK; AFLASPEYVNLPINGNGK; AFLASPEYVNLPINGNGKQ; ALPGQLKPFETLLSQNQGGK; ASCLYGQLPK; DQQEAALVDMVNDGVEDLR; FQDGDLTLYQSNTILR; YISLIYTNYEAGKDDYVK; PPYTVVYFPVR; MLLADQGQSWK; PMF; Comb 1 IPI00219757.12
787 S_Total95_365 IPI00295741.3 |SWISS-PROT:P07858 |TREMBL:Q6LAF9; Q503A6; Q8TAC7; Q5HYG5 |REFSEQ_NP:NP_680093; NP_680090; NP_680092; NP_001899; NP_680091 |ENSEMBL:ENSP00000345672; ENSP00000342070 |H-INV:HIT000034868; HIT000016937; HIT000022238 Tax_Id=9606 Cathepsin B precursor 11 ICEPGYSPTYK; EQWPQCPTIK; DIMAEIYK; GQDHCGIESEVVAGIPR; NGPVEGAFSVYSDFLLYK; DQGSCGSCWAFGAVEAISDR; GLVSGGLYESHVGCR; HYGYNSYSVSNSEK; SGVYQHVTGEMMGGHAIR; LPASFDAR; PMF; Comb 1 IPI00295741.3
788 S_Total95_394 IPI00385216.1 |TREMBL:Q7Z4Z9; Q9P0G7 |ENSEMBL:ENSP00000298248 |H-INV:HIT000007315 Tax_Id=9606 Lambda-crystallin 11 IFAQLDSIIDDR; LQYAIISEAWR; LYDIEQQQIR; HVLQTFGPIPEFSR; VPDDPEHLAAR; EVAGFVLNR; LFAGLVHVK; VILSSSTSCLMPSK; LVEEGIVSPSDLDLVMSEGLGMR; QCIVAHPVNPPYYIPLVELVPHPETAPTTVDR; Comb; PMF 1 IPI00385216.1
789 S_Total95_408 IPI00029665.8 |SWISS-PROT:Q96EY8 |REFSEQ_NP:NP_443077 |ENSEMBL:ENSP00000266839 |H-INV:HIT000035478 Tax_Id=9606 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial precursor 11 NDPSAESEGL; AGPILELEQWIDK; LSDYLFTLAR; GFSSTFTGER; IQCTLQDVGSALATPCSSAR; YTSQLPPLTAFILPSGGK; GHTFAEELQK; VVPLVQMGETDANVAK; GPQGVEDGDRPQPSSK; DDQVFEAVGTTDELSSAIGFALELVTEK; Comb 1 IPI00029665.8
790 S_Total95_415 IPI00294911.1 |SWISS-PROT:P21912 |TREMBL:Q70SX8 |REFSEQ_NP:NP_002991 |ENSEMBL:ENSP00000235768 |H-INV:HIT000033484 Tax_Id=9606 Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursor 11 NEVDSTLTFR; IKNEVDSTLTFR; DLVPDLSNFYAQYK; LQDPFSLYR; YLGPAVLMQAYR; QQYLQSIEER; AGDKPHMQTYEVDLNK; CGPMVLDALIK; CGPMVLDALIKIK; SCREGICGSCAMNINGGNTLACTRR; Comb 1 IPI00294911.1
791 S_Total95_514 IPI00442122.1 |TREMBL:Q6ZN40 Tax_Id=9606 Hypothetical protein FLJ16459 11 IQLVEEELDR; LEEAEKAADESER; RIQLVEEELDR; MEIQEIQLK; ATDAEADVASLNR; KATDAEADVASLNR; EENLSMHQMLDQTLLELNNM; GTEDELDKYSEALK; KLVIIESDLER; AEDSLLAAEEAAAK; Comb; PMF 1 IPI00442122.1
792 S_Total95_561 IPI00016568.1 |SWISS-PROT:P27144 |TREMBL:Q6NXQ5; Q8IUU9; Q6IBH4 |REFSEQ_NP:NP_001005353; NP_037542; NP_982289; NP_001002921 |ENSEMBL:ENSP00000294419; ENSP00000322175 |H-INV:HIT000009200; HIT000037499 Tax_Id=9606 Adenylate kinase isoenzyme 4, mitochondrial 11 DVAKPVIELYK; SLLVPDHVITR; IWPYVYTLFSNK; GQHWLLDGFPR; GVLHQFSGTETNK; RGQHWLLDGFPR; IWPYVYTLFSNKITPIQSKEAY; LMMSELENR; IAQNFGLQHLSSGHFLR; VYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAAR; Comb; PMF 1 IPI00016568.1
793 S_Total95_574 IPI00024919.3 |SWISS-PROT:P30048 |TREMBL:Q5T5V2 |REFSEQ_NP:NP_006784 |ENSEMBL:ENSP00000298510 |H-INV:HIT000039506; HIT000031097; HIT000039251; HIT000033021; HIT000034464 Tax_Id=9606 Thioredoxin-dependent peroxide reductase, mitochondrial precursor 11 DLSLDDFK; DYGVLLEGSGLALR; GLFIIDPNGVIK; HLSVNDLPVGR; NGGLGHMNIALLSDLTK; KNGGLGHMNIALLSDLTK; ANEFHDVNCEVVAVSVDSHFSHLAWINTPR; GTAVVNGEFK; AFQYVETHGEVCPANWTPDSPTIKPSPAASK; AFQYVETHGEVCPANWTPDSPTIK; PMF; Comb 2 IPI00024919.3, IPI00374151.1
794 S_Total95_577 IPI00029623.1 |SWISS-PROT:P60900 |TREMBL:Q9BZ93 |REFSEQ_NP:NP_002782 |ENSEMBL:ENSP00000261479 |H-INV:HIT000038178; HIT000031331; HIT000039494 Tax_Id=9606 Proteasome subunit alpha type 6 11 LYQVEYAFK; AINQGGLTSVAVR; HITIFSPEGR; ILTEAEIDAHLVALAERD; LLDSSTVTHLFK; KVPDKLLDSSTVTHLFK; DCAVIVTQK; CDPAGYYCGFK; IADISQVYTQNAEMR; ILTEAEIDAHLVALAER; PMF; Comb 1 IPI00029623.1
795 S_Total95_647 IPI00236556.1 |SWISS-PROT:P05164-3 |ENSEMBL:ENSP00000344419 Tax_Id=9606 Splice Isoform H7 of Myeloperoxidase precursor 11 IANVFTNAFR; VVLEGGIDPILR; VGPLLACIIGTQFR; FCGLPQPETVGQLGTVLR; IICDNTGITTVSK; NQADCIPFFR; QALAQISLPR; DFVNCSTLPALNLASWR; FPTDQLTPDQER; WLPAEYEDGFSLPYGWTPGVK; Comb 2 IPI00007244.1, IPI00236556.1
796 S_Total95_676 IPI00302688.6 |TREMBL:Q5TEG4 |H-INV:HIT000009070 Tax_Id=9606 OTTHUMP00000017171 11 ELYLEEALQNER; DLLGTVWGGPANLEAIAK; NALNIGMVEEVLQSSDETK; VIELENWTEGK; MNAFSGVMMLQLLEK; SLEEAQEWLK; EDNGIGILTLNNPSR; NTFSSGSDLNAVK; QFIQGPPEVIR; TLQQFPGGSIDLQK; Comb 3 IPI00479537.1, IPI00552067.1, IPI00302688.6
797 S_Total95_699 IPI00294398.1 |SWISS-PROT:Q16836 |REFSEQ_NP:NP_005318 |ENSEMBL:ENSP00000312288 |H-INV:HIT000029503 Tax_Id=9606 Short chain 3-hydroxyacyl-CoA dehydrogenase, mitochondrial precursor 11 TFESLVDFSK; DTPGFIVNR; TLSTIATSTDAASVVHSTDLVVEAIVENLK; FAAEHTIFASNTSSLQITSIANATTR; LGAGYPMGPFELLDYVGLDTTK; LLVPYLMEAIR; HPVSCKDTPGFIVNR; FAGLHFFNPVPVMK; FIVDGWHEMDAENPLHQPSPSLNK; HVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAK; Comb; PMF 1 IPI00294398.1
798 S_Total95_792-1 IPI00329694.1 |SWISS-PROT:Q13439-2 |TREMBL:Q86W71; Q59EW8; Q9H2G3 |ENSEMBL:ENSP00000349305 Tax_Id=9606 Splice Isoform 2 of Golgi autoantigen, golgin subfamily A member 4 11 ELSENINAVTLMK; EENPESDGEPVVEDGTSVK; KELSENINAVTLMK; SQTARIMELEDHITQK; TKLITQLRDAK; EQELEMTIKETINK; EITWLKEEGVK; ELQIQLELKSK; QTELESLSSELSEVLK; TLEKLDVKQTELESLSSELSEVLK; Comb; PMF 1 IPI00329694.1
799 S_Total95_792-2 IPI00220522.1 |SWISS-PROT:Q13439-4 |TREMBL:Q5GHI6 |ENSEMBL:ENSP00000273176 Tax_Id=9606 Splice Isoform 4 of Golgi autoantigen, golgin subfamily A member 4 11 ELSENINAVTLMK; EENPESDGEPVVEDGTSVK; KELSENINAVTLMK; SQTARIMELEDHITQK; TKLITQLRDAK; EQELEMTIKETINK; EITWLKEEGVK; ELQIQLELKSK; QTELESLSSELSEVLK; TLEKLDVKQTELESLSSELSEVLK; Comb; PMF 1 IPI00220522.1
800 S_Total95_816 IPI00218446.5 |SWISS-PROT:P11766 |TREMBL:Q6IRT1; Q5U043; Q6FHR2; Q6FI45 |REFSEQ_NP:NP_000662 |ENSEMBL:ENSP00000296412 |H-INV:HIT000036844 Tax_Id=9606 Class III alCohol dehydrogenase 5 Chi subunit 11 IIGVDINK; IIGVDINKDK; IRVTQGK; AAVAWEAGKPLSIEEIEVAPPK; AGDTVIPLYIPQCGECK; PLSIEEIEVAPPK; IIRDINGDAK; VDEFVTHNLSFDEINK; VCLLGCGISTGYGAAVNTAK; IKVDEFVTHNLSFDEINK; PMF; Comb 1 IPI00218446.5
801 S_Total95_821 IPI00022895.5 |SWISS-PROT:P04217 |TREMBL:Q7Z3U3; Q68CK0 |REFSEQ_NP:NP_570602 |ENSEMBL:ENSP00000263100 |H-INV:HIT000012815; HIT000012499 Tax_Id=9606 Alpha-1B-glycoprotein precursor 11 NGVAQEPVHLDSPAIK; VTLTCVAPLSGVDFQLR; ATWSGAVLAGR; CEGPIPDVTFELLR; SGLSTGWTQLSK; LELHVDGPPPR; SLPAPWLSMAPVSWITPGLK; HQFLLTGDTQGR; LHDNQNGWSGDSAPVELILSDETLPAPEFSPEPESGR; TPGAAANLELIFVGPQHAGNYR; PMF; Comb 1 IPI00022895.5
802 S_Total95_835 IPI00020042.2 |SWISS-PROT:P43686-1 |REFSEQ_NP:NP_006494 |ENSEMBL:ENSP00000157812 |H-INV:HIT000001730; HIT000036735; HIT000029536 Tax_Id=9606 Splice Isoform 1 of 26S protease regulatory subunit 6B 11 ENAPAIIFIDEIDAIATK; PQTGLSFLGPEPEDLEDLYSR; RLIFSTITSK; ILLELLNQMDGFDQNVNVK; AQDEIPALSVSR; EAVELPLTHFELYK; ELLKPNASVALHK; AQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSR; IQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVR; LQQELEFLEVQEEYIK; PMF; Comb 1 IPI00020042.2
803 S_Total95_844 IPI00008530.1 |SWISS-PROT:P05388 |TREMBL:Q53HW2; Q53HK9 |REFSEQ_NP:NP_444505; NP_000993 |ENSEMBL:ENSP00000339027 |H-INV:HIT000037258; HIT000032484; HIT000033645; HIT000030684; HIT000003787; HIT000030157; HIT000029538; HIT000031675; HIT000037032; HIT000034628; HIT000033851; HIT000029894; HIT000029335 Tax_Id=9606 60S acidic ribosomal protein P0 11 TSFFQALGITTK; CFIVGADNVGSK; IIQLLDDYPK; AFLADPSAFVAAAPVAAATTAAPAAAAAPAK; GNVGFVFTK; VLALSVETDYTFPLAEK; AGAIAPCEVTVPAQNTGLGPEK; NVASVCLQIGYPTVASVPHSIINGYK; DMLLANKVPAAAR; GTIEILSDVQLIK; PMF; Comb 1 IPI00008530.1
804 S_Total95_847 IPI00296913.1 |SWISS-PROT:Q9UKK9 |REFSEQ_NP:NP_054861 |ENSEMBL:ENSP00000298425 |H-INV:HIT000002067; HIT000029290 Tax_Id=9606 ADP-sugar pyrophosphatase 11 ELEEETGYK; EQTADGVAVIPVLQR; HANAKPFEVPFLK; PGDGEFVEVISLPK; QYIISEELISEGK; VYSYALALK; HANAKPFEVPFLKF; TLHYECIVLVK; PKPGDGEFVEVISLPK; KEQTADGVAVIPVLQR; PMF; Comb 1 IPI00296913.1
805 S_Total95_858 IPI00291643.3 |TREMBL:Q8WW59 |REFSEQ_NP:NP_997227 |ENSEMBL:ENSP00000338034 |H-INV:HIT000027159; HIT000039000 Tax_Id=9606 Hypothetical protein LOC283377 11 TAHSSLALFR; VGLLLEYEAQK; YGLVGLEPTK; EWAVVLADTAVTSGR; GPVVPAFALWDGELLTHSGLEVPEGL; IGVADVDMSR; LSLVDVSQVSVVHTLQTDFR; SWVFTYAQR; APVEGIGQPEK; DSCIGVDDR; PMF; Comb 1 IPI00291643.3
806 S_Total95_895 IPI00019987.1 |SWISS-PROT:P51687 |REFSEQ_NP:NP_000447 |ENSEMBL:ENSP00000266971; ENSP00000348440 Tax_Id=9606 Sulfite oxidase, mitochondrial precursor 11 DGETVESGEVTIK; VAPTVETSDPYADDPVR; AVDDGYNVQPDTVAPIWNLR; NHLPVPNLDPDTYR; VDVSLDGGLTWQVAK; IGELNPEDK; VVVPGVVGAR; LHVVGAPGGQSLSLSLDDLHNFPR; VNSQRPFNAEPPPELLTENYITPNPIFFTR; AMDPEAEVLLAYEMNGQPLPR; PMF; Comb 1 IPI00019987.1
807 S_Total95_1010 IPI00219655.3 |SWISS-PROT:O14832 |TREMBL:Q6FGQ2; Q5TB63 |REFSEQ_NP:NP_006205 |ENSEMBL:ENSP00000263038 |H-INV:HIT000040793 Tax_Id=9606 Phytanoyl-CoA hydroxylase 11 FFGAENSVNLK; YCTLPEILK; AISCHFASADCHYIDVK; GDTVFFHPLLIHGSGQNK; KFYEENGFLVIK; VQDFQEDKELFR; KEVKPLGLTVMR; NNGCLVVLPGTHK; MFHGIQDYEENK; NLVPDADIQR; Comb; PMF 1 IPI00219655.3
808 S_Total95_1034 IPI00430856.1 |TREMBL:Q6GMY2 Tax_Id=9606 Hypothetical protein 11 QVGSGVTTDQVQAEAK; FTCTVTHTDLPSPLK; NVPLPVIAELPPK; VFAIPPSFASIFLTK; YAATSQVLLPSK; LICQATGFSPR; VSVFVPPR; DVMQGTDEHVVCK; YVTSAPMPEPQAPGR; GVALHRPDVYLLPPAR; Comb; PMF 2 IPI00479169.1, IPI00430856.1
809 S_Total95_1039 IPI00015285.3 |SWISS-PROT:Q99447 |TREMBL:Q6IBM3 |REFSEQ_NP:NP_002852 |ENSEMBL:ENSP00000331719 |H-INV:HIT000034779; HIT000029543 Tax_Id=9606 Ethanolamine-phosphate cytidylyltransferase 11 TQGVSTTDLVGR; WVDEVVPAAPYVTTLETLDK; YVSEVVIGAPYAVTAELLSHFK; QIDSGSNLTTDLIVQR; NPWTGVSQFLQTSQK; GPPVFTQEER; ELAFLEAAR; AMGDYLIVGVHTDEEIAK; DGSDPYQEPK; TEIIPDRDGSDPYQEPK; PMF; Comb 1 IPI00015285.3
810 S_Total95_1094 IPI00470891.1 |SWISS-PROT:O75534-1 |TREMBL:Q5TF05; Q68DI9 |REFSEQ_NP:NP_001007554 |ENSEMBL:ENSP00000351329 |H-INV:HIT000000602 Tax_Id=9606 Hypothetical protein DKFZp779J1455 11 IKQEILPEER; ATNIEVLSNTFQFTNEAR; DVEGSTSPQIGDK; DQFGFINYEVGDSK; EAEDGIIAYDDCGVK; LLGYVATLK; NITLDDASAPR; GDLETLQPGDDVEFTIK; KLPKGTVSFHSHSDHR; SPAAPGQSPTGSVCYER; Comb; PMF 1 IPI00470891.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home