Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
811 S_Total95_1103 IPI00105598.2 |SWISS-PROT:O00231 |TREMBL:Q53FT5 |REFSEQ_NP:NP_002806 |ENSEMBL:ENSP00000261712 |H-INV:HIT000031936; HIT000029623 Tax_Id=9606 26S proteasome non-ATPase regulatory subunit 11 11 DIQENDEEAVQVK; EQSILELGSLLAK; EASIDILHSIVK; LYDNLLEQNLIR; VQIEHISSLIK; YVRPFLNSISK; TGQAAELGGLLK; TTANAIYCPPK; YQEALHLGSQLLR; DDPIISTHLAK; Comb 1 IPI00105598.2
812 S_Total95_1118 IPI00216682.5 |SWISS-PROT:Q15417 |TREMBL:Q6FHA7; Q9BWY6 |REFSEQ_NP:NP_001830 |ENSEMBL:ENSP00000281863 |H-INV:HIT000039910 Tax_Id=9606 Calponin-3 11 DYQYSDQGIDY; NWIEEVTGMSIGPNFQLGLK; YDHQAEEDLR; VNESSLNWPQLENIGNFIK; DGIILCELINK; GFHTTIDIGVK; AGQSVIGLQMGTNK; GASQAGMLAPGTR; GPSYGLSAEVK; MQTDKPFDQTTISLQMGTNK; PMF; Comb 1 IPI00216682.5
813 S_Total95_1163 IPI00008223.3 |SWISS-PROT:P54727 |TREMBL:Q5W0S4; Q7Z5K8; Q5W0S5; Q53F10 |REFSEQ_NP:NP_002865 |ENSEMBL:ENSP00000350708; ENSP00000262560 |H-INV:HIT000039060 Tax_Id=9606 UV excision repair protein RAD23 homolog B 11 IDIDPEETVK; ILNDDTALK; QIIQQNPSLLPALLQQIGR; NENLAANFLLQQNFDED; NFVVVMVTKPK; PAETPVATSPTATDSTSGDSSR; NQPQFQQMR; QEKPAEKPAETPVATSPTATDSTSGDSSR; PAEKPAETPVATSPTATDSTSGDSSR; SNLFEDATSALVTGQSYENMVTEIMSMGYER; Comb; PMF 1 IPI00008223.3
814 S_Total95_1176 IPI00027444.1 |SWISS-PROT:P30740 |TREMBL:Q5W0E1; Q53FB9 |REFSEQ_NP:NP_109591 |ENSEMBL:ENSP00000229479 |H-INV:HIT000034141 Tax_Id=9606 Leukocyte elastase inhibitor 11 KIEEQLTLEK; TYNFLPEFLVSTQK; LEESYTLNSDLAR; TYGADLASVDFQHASEDAR; LGVQDLFNSSK; FKLEESYTLNSDLAR; IEEQLTLEK; IPELLASGMVDNMTK; PENLDFIEVNVSLPRFK; TFHFNTVEEVHSR; PMF; Comb 1 IPI00027444.1
815 S_Total95_1214 IPI00215894.1 |SWISS-PROT:P01042-2 |TREMBL:Q53EQ0; Q6PAU9 |REFSEQ_NP:NP_000884 |ENSEMBL:ENSP00000287611 Tax_Id=9606 Splice Isoform LMW of Kininogen precursor 11 ENFLFLTPDCK; TVGSDTFYSFK; IASFSQNCDIYPGK; KYFIDFVAR; YNSQNQSNNQFVLYR; DAAKAATGECTATVGKR; ESNEELTESCETK; DIPTNSPELEETLTHTITK; IGEIKEETTSHLR; ESNEELTESCETKKLGQSLDCNAEVYVVPWEK; PMF; Comb 1 IPI00215894.1
816 S_Total95_1294 IPI00377261.1 |SWISS-PROT:Q96I24-1 |TREMBL:Q5VYR6 |ENSEMBL:ENSP00000318177 Tax_Id=9606 Splice Isoform 1 of Far upstream element binding protein 3 11 SINQQSGAHVELQR; AEGFVDALHR; MVMIQDGPLPTGADK; GDWSVGAPGGVQEITYTVPADK; MGGGSIEVSVPR; RPLDDGVGNQLGALVHQR; IQFKPDDGISPER; IQIASESSGIPERPCVLTGTPESIEQAK; IDSIPHLNNSTPLVDPSVYGYGVQK; MAELVQGQSAPVGMKAEGFVDALHR; PMF 1 IPI00377261.1
817 S_Total95_1298 IPI00257508.4 |SWISS-PROT:Q16555 |TREMBL:Q59GB4; Q53ET2; Q8NAN9 |REFSEQ_NP:NP_001377 |ENSEMBL:ENSP00000309539 |H-INV:HIT000017244 Tax_Id=9606 Dihydropyrimidinase related protein-2 11 QIGENLIVPGGVK; MSVIWDKAVVTGK; FQLTDCQIYEVLSVIR; GLYDGPVCEVSVTPK; KPFPDFVYKR; NLHQSGFSLSGAQIDDNIPR; AITIANQTNCPLYITK; FQMPDQGMTSADDFFQGTK; GIQEEMEALVK; KKGTVVYGEPITASLGTDGSHYWSK; Comb; PMF 1 IPI00257508.4
818 S_Total95_1327 IPI00014177.1 |SWISS-PROT:Q15019 |TREMBL:Q53QU3 |REFSEQ_NP:NP_001008492; NP_001008491; NP_006146; NP_004395 |ENSEMBL:ENSP00000353157; ENSP00000337657 |H-INV:HIT000042294; HIT000036711 Tax_Id=9606 Septin-2 11 VNIVPVIAK; ASIPFSVVGSNQLIEAK; STLINSLFLTDLYPER; TIISYIDEQFER; ILDEIEEHNIK; LTVVDTPGYGDAINCR; LYPWGVVEVENPEHNDFLK; QQPTQFINPETPGYVGFANLPNQVHR; KVENEDMNKDQILLEK; TMLITHMQDLQEVTQDLHYENFR; PMF; Comb 1 IPI00014177.1
819 S_Total95_1331 IPI00025019.3 |SWISS-PROT:P20618 |TREMBL:Q5TIK0 |REFSEQ_NP:NP_002784 |ENSEMBL:ENSP00000262193 |H-INV:HIT000038973; HIT000014656; HIT000006564 Tax_Id=9606 Proteasome subunit beta type 1 11 DVFISAAER; AGGSASAMLQPLLDNQVGFK; GAVYSFDPVGSYQR; LSEGFSIHTR; AMTTGAIAAMLSTILYSR; EGIREETVSLR; TVIGCSGFHGDCLTLTK; FFPYYVYNIIGGLDEEGK; DVYTGDALR; NMQNVEHVPLSLDR; Comb; PMF 2 IPI00025019.3, IPI00604437.1
820 S_Total95_1337 IPI00478835.1 |ENSEMBL:ENSP00000353080 Tax_Id=9606 73 kDa protein 11 LTTEDLVNLGK; YIELDGDRLTTEDLVNLGK; LQELQVNLVR; TVVYGITTGFGK; ALDYLAIGIHELAAISER; GYSGISLETLK; EGLALINGTQMITSLGCEAVER; NIITTELNSATDNPMVFANR; SLLDSDHHPSEIAESHR; NKPDNGGFTSVDDAHFLVR; Comb; PMF 2 IPI00031425.1, IPI00478835.1
821 S_Total95_1381 IPI00478021.3 |TREMBL:Q5T2M3 |ENSEMBL:ENSP00000347405 Tax_Id=9606 OTTHUMP00000017872 11 FEVEVTK; NGKLMESTPK; YVVVFNCSDQMDFRGLGR; GLKDWQAFLDLKK; KIDPVTMDPEKSCCK; EESEAVDTLR; EMPEPTGDEPEDSVFEVPK; LMEASESVAKLSQDLAVK; HPETGKLLVNFDPK; MLPTPSKFHYIFNLRDLSR; PMF 2 IPI00014845.9, IPI00478021.3
822 S_Total95_1410 IPI00221338.3 |SWISS-PROT:O95486 |REFSEQ_XP:XP_094581 |ENSEMBL:ENSP00000265341 |H-INV:HIT000009819; HIT000025965 Tax_Id=9606 PREDICTED: SEC24 related gene family, member A 11 LFPLFVLALLK; LPLGLLLHPFK; CTLTSIPQTQALLNK; DLVQLPVVTSSTIVR; LNCNPELFR; TLETQSALGPALQAAFK; TYINPFVSFIDQR; SSVLSNQQPGLMVPFSLR; VNDVPEEFLYNPLTR; VDNLSDEGALNISDR; Comb 1 IPI00221338.3
823 S_Total95_1418 IPI00219678.2 |SWISS-PROT:P05198 |TREMBL:Q53XC0 |REFSEQ_NP:NP_004085 |ENSEMBL:ENSP00000256383 |H-INV:HIT000030955 Tax_Id=9606 Eukaryotic translation initiation factor 2 subunit 1 11 TAWVFDDKYK; ADIEVACYGYEGIDAVK; VVTDTDETELAR; ENAEVDGDDDAEEMEAK; DEQLESLFQR; FPEVEDVVMVNVR; INLIAPPR; AGLNCSTENMPIK; GVFNVQMEPK; TEGLSVLSQAMAVIK; Comb 1 IPI00219678.2
824 S_Total95_1510 IPI00465084.5 |SWISS-PROT:P17661 |TREMBL:Q9H319; Q5RLN1; Q549R7; Q5RLN0; Q549R9; Q5RLN2; Q9GZR6; Q53SB5; Q549R8 |REFSEQ_NP:NP_001918 |ENSEMBL:ENSP00000273074 |H-INV:HIT000023162; HIT000041427; HIT000005361 Tax_Id=9606 Desmin 11 KLLEGEESR; EYQDLLNVK; VELQELNDR; TNEKVELQELNDR; FASEASGYQDNIAR; FLEQQNAALAAEVNR; INLPIQTYSALNFR; IESLNEEIAFLK; DGEVVSEATQQQHEVL; TFGGAPGFPLGSPLSSPVFPR; Comb; PMF 1 IPI00465084.5
825 S_Total95_1535 IPI00477957.1 |TREMBL:Q8N0X4; Q5JVC0; Q8TDH8; Q5W0F7 |REFSEQ_NP:NP_996531; NP_612124 |ENSEMBL:ENSP00000342991; ENSP00000316738 |H-INV:HIT000020361; HIT000042105 Tax_Id=9606 Citrate lyase beta like 11 TLEDIDLGPTEK; VNSVSSGLAEEDLETLLQSR; QVIHPNQIAVVQEQFSPSPEK; WAEELIAAFK; IPSLNVDCAVLDCEDGVAANK; AVLYVPGNDEK; QAQNTVTLATSIK; AFGLQAIDLVYIDFR; GAFTFQGSMIDMPLLK; KIPSLNVDCAVLDCEDGVAANK; Comb; PMF 1 IPI00477957.1
826 S_Total95_1544 IPI00009368.2 |SWISS-PROT:Q9H9B4 |REFSEQ_NP:NP_073591 |ENSEMBL:ENSP00000316905 |H-INV:HIT000038801; HIT000013529; HIT000006212 Tax_Id=9606 Sideroflexin 1 11 NILLTNEQLESAR; ANHFFTVTDPR; QAITQVVVSR; YIYDSAFHPDTGEK; WDQSTFIGR; SSMSVTSLEAELQAK; QGIVPPGLTENELWR; ILMAAPGMAIPPFIMNTLEK; SGDAPLTVNELGTAYVSATTGAVATALGLNALTK; TTPAVLFWQWINQSFNAVVNYTNR; Comb 1 IPI00009368.2
827 S_Total95_1571 IPI00021263.3 |SWISS-PROT:P63104 |TREMBL:Q5XJ08; Q6LD62 |REFSEQ_NP:NP_003397; NP_663723 |ENSEMBL:ENSP00000309503; ENSP00000297569 Tax_Id=9606 14-3-3 protein zeta/delta 11 DSTLIMQLLR; NLLSVAYK; DICNDVLSLLEK; SVTEQGAELSNEER; YLAEVAAGDDKK; GIVDQSQQAYQEAFEISK; TAFDEAIAELDTLSEESYK; YLAEVAAGDDK; FLIPNASQAESK; DNLTLWTSDTQGDEAEAGEGGEN; Comb; PMF 1 IPI00021263.3
828 S_Total95_1722 IPI00030116.1 |SWISS-PROT:O95394 |TREMBL:Q5JWR4 |REFSEQ_NP:NP_056414 |ENSEMBL:ENSP00000283977 |H-INV:HIT000024605; HIT000006706; HIT000030266; HIT000006983 Tax_Id=9606 Phosphoacetylglucosamine mutase 11 IATLISSFLK; EAVNLQQDAFVVIGR; LNHLCGADFVK; AFVRPSGTEDVVR; GLTVQQWDALYTDLPNR; QAVTPPGLQEAINDLVK; AEHLDHVMFR; MGLLAVLR; YLEEVMKVPVYCTK; LVDPLGEMLAPSWEEHATCLANAEEQDMQR; Comb 1 IPI00030116.1
829 S_Total95_2095 IPI00027258.3 |SWISS-PROT:Q8N3V7-2 |REFSEQ_NP:NP_009217 |ENSEMBL:ENSP00000302139 |H-INV:HIT000000746 Tax_Id=9606 Splice Isoform 2 of Synaptopodin 11 PSLFVLSPIKEPAKVSPR; YPTNAPGAFRVASR; PSSLDLVPNLPK; PSTLCADGQPQAPAEEVR; VTPNPDLLDLVQTADEK; DQGEVGVEEEPFALGAEASNFQQEPAPR; PFGIQAPGGTSQMER; RPLGNFTAPPTYTETLSTAPLASWVR; PGSAAVPGAAFAPIPR; SPTDSDVSLDSEDSGAK; PMF 1 IPI00027258.3
830 S_Total95_2271 IPI00386271.3 |SWISS-PROT:O75746 |TREMBL:Q96AM8 |REFSEQ_NP:NP_003696 |ENSEMBL:ENSP00000263812 |H-INV:HIT000015938; HIT000006102; HIT000037756 Tax_Id=9606 Calcium-binding mitochondrial carrier protein Aralar1 11 GLIPQLIGVAPEK; LQVAGEITTGPR; LTVNDFVR; AGQTTYSGVIDCFR; YEGFFGLYR; IYSTLAGTR; KIYSTLAGTRK; SPSVAVVQPK; LATATFAGIENK; HLNYTEFTQFLQELQLEHAR; PMF 1 IPI00386271.3
831 S_Total95_2384 IPI00219217.2 |SWISS-PROT:P07195 |TREMBL:Q5U077 |REFSEQ_NP:NP_002291 |ENSEMBL:ENSP00000229319 |H-INV:HIT000030829; HIT000037014 Tax_Id=9606 L-lactate dehydrogenase B chain 11 VIGSGCNLDSAR; LIAPVAEEEATVPNNK; HRVIGSGCNLDSARFR; ITVVGVGQVGMACAISILGK; IVVVTAGVR; LKDDEVAQLK; IVADKDYSVTANSK; SADTLWDIQK; SLADELALVDVLEDK; GYTNWAIGLSVADLIESMLK; GEMMDLQHGSLFLQTPK 1 IPI00219217.2
832 S_Total95_2392 IPI00554676.1 |SWISS-PROT:P69892 |TREMBL:Q14402; Q9UJ01; Q14412; Q14474; Q9UNL6; Q96FH6; Q14476 |REFSEQ_NP:NP_000175 |ENSEMBL:ENSP00000338082 |H-INV:HIT000040741; HIT000035115 Tax_Id=9606 Hemoglobin gamma-2 chain 11 LLVVYPWTQR; VNVEDAGGETLGR; FFDSFGNLSSASAIMGNPK; KVLTSLGDAIK; VLTSLGDAIKHLDDLK; GTFAQLSELHCDK; MVTGVASALSSR; ATITSLWGK; VLTSLGDAIK; LLGNVLVTVLAIHFGK; LHVDPENFK 1 IPI00554676.1
833 S_Total95_2453 IPI00382606.1 |TREMBL:Q96PQ8 Tax_Id=9606 Factor VII active site mutant immunoconjugate 11 NQVSLTCLVK; EPQVYTLPPSR; VVSVLTVLHQDWLNGK; FNWYVDGVEVHNAK; TPEVTCVVVDVSHEDPEVK; THTCPPCPAPELLGGPSVFLFPPKPK; THTCPPCPAPELLGGPSVFLFPPK; EPQVYTLPPSRDELTK; GFYPSDIAVEWESNGQPENNYK; TTPPVLDSDGSFFLYSK; LMTQDCLQQSR 1 IPI00382606.1
834 S_Total95_2507 IPI00180730.1 |ENSEMBL:ENSP00000333488 Tax_Id=9606 50 kDa protein 11 EHALLAYTLGVK; LPLQDVYK; QLIVGVNK; NGQTREHALLAYTLGVK; PGMVVTFAPVNVTTEVK; THINIVVIGHVDSGK; STTTGHLIYK; MDSTEPPYSQK; SGDAAIVDMVPGK; DMRHTVAVGVIKAVDK; VETGILKPGMVVTFAPVNVTTEVK 1 IPI00180730.1
835 S_Total95_2552 IPI00299778.2 |SWISS-PROT:Q15166 |REFSEQ_NP:NP_000931 |ENSEMBL:ENSP00000265627 |H-INV:HIT000020969 Tax_Id=9606 Serum paraoxonase/lactonase 3 11 AQALEISGGFDK; YVYVADVAAK; SVNDIVVLGPEQFYATR; LLNYNPEDPPGSEVLR; GFCSANGITVSADQK; IFLMDLNEQNPR; IQNVLSEKPR; YPGMPNFAPDEPGK; HDNWDLTQLK; VIQLGTLVDNLTVDPATGDILAGCHPNPMK; EVEPVEPENCHLIEELESGSEDIDILPSGLAFISSGLK 1 IPI00299778.2
836 S_Total95_2580 IPI00248359.4 |REFSEQ_XP:XP_292982 |ENSEMBL:ENSP00000340610 Tax_Id=9606 PREDICTED: similar to POTE2A 11 IWHHTFYNELR; AVFPSIVGRPR; QEYDESGPSIVHR; AGFAGDDAPR; AVFPSIVGR; QEYDESGPSIVHRK; VAPEEHPILLTEAPLNPK; CPEALFQPCFLGMESCGIHETTFNSIMK; QMLKISSENSNPEQDLK; KDLIVMLRDTDVNK; NKHGLTPLLLGVHEQKQQVVK 1 IPI00248359.4
837 S_Total95_2591 IPI00164300.7 |REFSEQ_XP:XP_208658 |ENSEMBL:ENSP00000343752 Tax_Id=9606 PREDICTED: similar to Succinyl-CoA ligase 11 DPNVVGQLAK; FFVADTANEALEAAK; LYNLFLK; EQIDIFEGIK; FLVARSR; IDATQVEVNPFGETPEGQVVCFDAK; FFVADTANEALEAAKR; SENEPIENEAAK; VMVAEALDISR; MAENLGFVGPLK; VEAILVNIFGGIVNCAIIANGITK 1 IPI00164300.7
838 S_Total95_2650 IPI00028196.4 |TREMBL:Q9C098 |REFSEQ_XP:XP_047355 |ENSEMBL:ENSP00000295943 |H-INV:HIT000001481 Tax_Id=9606 PREDICTED: KIAA1765 protein 11 TVIIEQSWGSPK; VGEVIVTK; TALLDAAGVASLLTTAEVVVTEIPK; TALLDAAGVASLLTTAEVVVTEIPKEEK; DRVTDALNATR; GANPVEIR; VGEVIVTKDDAMLLK; VTDALNATR; GKGGNAQIEK; GVMLAVDAVIAEPK; GVMLAVDAVIAEPKK 1 IPI00028196.4
839 S_Total95_2730 IPI00420053.2 |TREMBL:Q96IK3 |REFSEQ_NP:NP_003818 |ENSEMBL:ENSP00000263354 |H-INV:HIT000033218; HIT000040503; HIT000023231; HIT000030188 Tax_Id=9606 Alpha-soluble NSF attachment protein 11 TIQGDEEDLR; LLEAHEEQNVDSYTESVK; YEELFPAFSDSR; LDQWLTTMLLR; AIAHYEQSADYYK; VAGYAALLEQYQK; NSQSFFSGLFGGSSK; HDAATCFVDAGNAFK; IEEACEIYAR; AIDIYEQVGTNAMDSPLLK; KADPQEAINCLMR 1 IPI00420053.2
840 S_Total95_2766 IPI00219525.9 |SWISS-PROT:P52209 |REFSEQ_NP:NP_002622 |ENSEMBL:ENSP00000270776 |H-INV:HIT000029558 Tax_Id=9606 6-phosphogluconate dehydrogenase, decarboxylating 11 AGQAVDDFIEK; VDDFLANEAK; LVPLLDTGDIIIDGGNSEYR; DAFDRNPELQNLLLDDFFK; NPELQNLLLDDFFK; GILFVGSGVSGGEEGAR; VGTGEPCCDWVGDEGAGHFVK; SAVENCQDSWR; WTAISALEYGVPVTLIGEAVFAR; DVLGMAQDEMAQAFEDWNK; DYFGAHTYELLAK 1 IPI00219525.9
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home