Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
841 S_Total95_2874 IPI00397676.3 |REFSEQ_XP:XP_371115 |ENSEMBL:ENSP00000352313 Tax_Id=9606 PREDICTED: similar to 60S ribosomal protein L7a (Surfeit locus protein 3) (PLA-X polypeptide) 11 NFGIGQDIQPK; VAPAPAVVK; AGVNTVTTLVENKK; VPPAINQFTQALDR; AGVNTVTTLVENK; KMGVPYCIIKGK; TCTTVAFTQVNSEDK; MGVPYCIIKGKAR; HWGGNVLGPK; RLKVPPAINQFTQALDR; VSCGRPGVLRAALGGGPR 1 IPI00397676.3
842 S_Total95_2901 IPI00003918.4 |SWISS-PROT:P36578 |REFSEQ_NP:NP_000959 |ENSEMBL:ENSP00000311430 |H-INV:HIT000036833; HIT000034839; HIT000034646; HIT000030351; HIT000033578; HIT000032456 Tax_Id=9606 60S ribosomal protein L4 11 NVTLPAVFK; IEEVPELPLVVEDK; IEEVPELPLVVEDKVEGYK; NIPGITLLNVSK; LDELYGTWR; GPCIIYNEDNGIIK; KLDELYGTWR; YAICSALAASALPALVMSK; FCIWTESAFR; AAAAAAALQAK; APIRPDIVNFVHTNLR 2 IPI00471915.1, IPI00003918.4
843 S_Total95_2971 IPI00180305.4 |TREMBL:O75050; Q7L8P7; Q8WV67; Q8IXJ4; O60646; Q5T4S7; Q5T4S9; Q5TBN8; Q8TDN5; Q6DKH8; Q5TBP2; Q9P2N9; Q5T4S8; Q6P4A4 |REFSEQ_NP:NP_065816 |ENSEMBL:ENSP00000248008 |H-INV:HIT000001022; HIT000000179; HIT000005847; HIT000023874; HIT000002806; HIT000038399; HIT000003707; HIT000008423; HIT000006198; HIT000012832; HIT000007100 Tax_Id=9606 Retinoblastoma-associated factor 600 11 EDYLAVCGLK; NLQGFLEQPK; ASAQGDPDVPECLK; WSSRLRISSYVNWIK; GIKKLLEEQGIFLR; EEVRQLMCLLTR; KKAVSNINTLLDK; EDDYESDAATIVQK; MNYSGDQGQTIR; LEQVSSDEGIGTLAENLLEALR; VNEAAPEKPQDDSGTAGGISSTSASVNR 1 IPI00180305.4
844 S_Total95_2982 IPI00002243.2 |SWISS-PROT:P36269-1 |TREMBL:Q53XM9; Q6GMP0 |REFSEQ_NP:NP_004112 |ENSEMBL:ENSP00000330080 |H-INV:HIT000035218 Tax_Id=9606 Gamma-glutamyltransferase-like activity 1 11 EGSQLTLQDLAK; DLLGETLAQLIR; LPWAQLFQPTIALLR; TGIILNNELLDLCER; AAIAAPILHVNSK; GCVEYEPNFSQEVQR; VNVYHHLVETLK; LGQMLVEDIAK; PSLQASTLR; MARGYGATVSLVLLGLGLALAVIVLAVVLSR; ETVPASHAPSLLDQCAQALPLGTGAQWIGVPGELR 1 IPI00002243.2
845 S_Total95_2988 IPI00033025.7 |SWISS-PROT:Q16181 Tax_Id=9606 Septin-7 11 VNIIPIIAK; DVTNNVHYENYR; NLEGYVGFANLPNQVYR; ADTLTPEECQQFKK; FEDYLNAESR; IYEFPETDDEEENKLVK; ADTLTPEECQQFK; KMEMEMEQVFEMKVK; IYEFPETDDEEENK; LAAVTYNGVDNNK; SPLAQMEEER 3 IPI00604561.1, IPI00552502.2, IPI00033025.7
846 S_Total95_2993 IPI00032328.1 |SWISS-PROT:P01042-1 |ENSEMBL:ENSP00000265023 Tax_Id=9606 Splice Isoform HMW of Kininogen precursor 11 ENFLFLTPDCK; TVGSDTFYSFK; IASFSQNCDIYPGK; KYFIDFVAR; YNSQNQSNNQFVLYR; DAAKAATGECTATVGKR; ESNEELTESCETK; DIPTNSPELEETLTHTITK; ESNEELTESCETKKLGQSLDCNAEVYVVPWEK; TEHLASSSEDSTTPSAQTQEK; LDDDLEHQGGHVLDHGHK 1 IPI00032328.1
847 S_Total95_2996 IPI00031023.1 |SWISS-PROT:Q13045 |REFSEQ_NP:NP_002009 |ENSEMBL:ENSP00000324573 |H-INV:HIT000039889 Tax_Id=9606 Flightless-I protein homolog 11 ENPNLVMPPKPADR; WDQGLEKPR; TGLCYLPEELAALQK; LAGASPATVAAAAAAGSGPK; NAEAVLQSPGLSGK; QLPAMTALQTLHLR; AVQGAQQPSLYQIR; LAEDILNTMFDTSYSK; KLYLNSNKLDFDGLPSGIGK; TQSNLPTSLEGLSNLADVDLSCNDLTR; VGLGLGYLELPQINYK 1 IPI00031023.1
848 S_Total95_3222 IPI00604699.1 |SWISS-PROT:P30464; P30484 |TREMBL:Q30191; Q6F3I0; Q8HWT4; Q6F3G9; O78144; Q8MHP6; Q6F3I1; Q29985; O19781; Q30172; Q95349; Q6F3G8 |H-INV:HIT000009869 Tax_Id=9606 HLA class I histocompatibility antigen, B-15 alpha chain precursor 11 WAAVVVPSGEEQR; CWALGFYPAEITLTWQR; FIAVGYVDDTQFVR; APWIEQEGPEYWDR; MYGCDVGPDGR; DYIALNEDLSSWTAADTAAQITQR; AYLEGLCVEWLR; DGEDQTQDTELVETR; YTCHVQHEGLPK; DGEDQTQDTELVETRPAGDR; THVTHHPISDHEATLR 4 IPI00604699.1, IPI00604557.1, IPI00604470.1, IPI00552353.3
849 S_Total95_3230 IPI00479242.1 |SWISS-PROT:P30460 |TREMBL:Q5SS57 Tax_Id=9606 HLA class I histocompatibility antigen, B-8 alpha chain precursor 11 WAAVVVPSGEEQR; FISVGYVDDTQFVR; AYLEGTCVEWLR; SWTAADTAAQITQR; CWALGFYPAEITLTWQR; APWIEQEGPEYWDR; DGEDQTQDTELVETR; YTCHVQHEGLPK; DGEDQTQDTELVETRPAGDR; THVTHHPISDHEATLR; YLENGKDTLERADPPK 2 IPI00479242.1, IPI00472676.1
850 S_Total95_3338 IPI00470498.1 |SWISS-PROT:Q8NC51-3 |TREMBL:Q5VU20 |REFSEQ_NP:NP_001018079 Tax_Id=9606 Splice Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein 11 SSASAPDVDDPEAFPALA; FDQLFDDESDPFEVLK; SAAQAAAQTNSNAAGK; ENEVEEVKEEGPK; GEGGEFSVDRPIIDR; NPLPPSVGVVDK; SEEAHAEDSVMDHHFR; KNPLPPSVGVVDK; KPANDITSQLEINFGDLGR; RPDQQLQGEGK; DELTDLDQSNVTEETPEGEEHHPVADTENK 2 IPI00470498.1, IPI00412714.3
851 S_Total95_3339 IPI00410693.3 |SWISS-PROT:Q8NC51-1 |TREMBL:Q5VU19 |REFSEQ_NP:NP_001018077 |ENSEMBL:ENSP00000271011 |H-INV:HIT000031389 Tax_Id=9606 Splice Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 11 SSASAPDVDDPEAFPALA; FDQLFDDESDPFEVLK; SAAQAAAQTNSNAAGK; ENEVEEVKEEGPK; GEGGEFSVDRPIIDR; NPLPPSVGVVDK; SEEAHAEDSVMDHHFR; KNPLPPSVGVVDK; KPANDITSQLEINFGDLGR; RPDQQLQGEGK; GGSGSHNWGTVKDELTESPK 2 IPI00470497.3, IPI00410693.3
852 S_Total95_3630 IPI00022361.1 |SWISS-PROT:P02730 |TREMBL:Q6LDU9; P78488 |REFSEQ_NP:NP_000333 |ENSEMBL:ENSP00000262418 Tax_Id=9606 Band 3 anion transport protein 11 ADFLEQPVLGFVR; ASTPGAAAQIQEVK; LQEAAELEAVELPVPIR; NVELQCLDADDAK; PHLSHLTFWSLLELR; VLLPLIFR; IPPDSEATLVLVGR; GWVIHPLGLR; VYVELQELVMDEK; HSHAGELEALGGVKPAVLTR; FLFVLLGPEAPHIDYTQLGR 1 IPI00022361.1
853 S_Total95_3768 IPI00220637.4 |SWISS-PROT:P49591 |TREMBL:Q5T5C8; Q53HA4 |REFSEQ_NP:NP_006504 |ENSEMBL:ENSP00000234677 |H-INV:HIT000034329; HIT000029861 Tax_Id=9606 Seryl-tRNA synthetase 11 ELVSCSNCTDYQAR; IEQFVYSSPHDNK; TICAILENYQTEK; YLIATSEQPIAALHR; LDLEAWFPGSGAFR; EVMQEVAQLSQFDEELYK; DEWLRPEDLPIK; FKDPGLVDQLVK; KEPVGDDESVPENVLSFDDLTADALANLK; EPVGDDESVPENVLSFDDLTADALANLK; VLDLDLFR 1 IPI00220637.4
854 S_Total95_3772 IPI00217952.6 |SWISS-PROT:Q06210-1 |ENSEMBL:ENSP00000349860 Tax_Id=9606 Splice Isoform 1 of Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1 11 ESQDTSFTTLVER; GYHYATCLEGALK; PVVICDKEDTETIK; RGSPLLIGVR; VNFDDYTVNLGGLK; GYDFESETDTETIAK; VIQQLEGAFALVFK; AVQTLQMELQQIMK; EIFEQPESVVNTMR; EIMLGLKRLPDLIK; WATHGEPSPVNSHPQR 2 IPI00299506.5, IPI00217952.6
855 S_Total95_3822 IPI00328170.8 |SWISS-PROT:Q13724 |TREMBL:Q58F09 |REFSEQ_NP:NP_006293 |ENSEMBL:ENSP00000233616 |H-INV:HIT000031199 Tax_Id=9606 Mannosyl-oligosaccharide glucosidase 11 GFLWDEGFHQLVVQR; IPISIEFVFESGSAQAGGNQALPR; LGPLLDILADSR; VDPALFPPVPLFTAVPSR; FTLLPPTSPGDTAPK; SLAASSSFYGQR; LAGSLLTQALESHAEGFR; AVQLKPRPPQGLVR; GRDPALPTLLNPK; EALGHWLGLLNADGWIGR; LNSWFQHRPPGASPER 1 IPI00328170.8
856 S_Total95_3824 IPI00396593.3 |SWISS-PROT:Q96JY6-1 |REFSEQ_NP:NP_067643 |ENSEMBL:ENSP00000312634 |H-INV:HIT000017835; HIT000011072; HIT000039213 Tax_Id=9606 Splice Isoform 1 of PDZ and LIM domain protein 2 11 GGTPAFLPSSLSPQSSLPASR; LLQEALEAEER; SFQSLACSPGLPAADR; FQGSVRTYTESQSSLR; TYTESQSSLR; AGSPFSPPPSSSSLTGEAAISR; SQATSPGQTNGDSSLEVLATR; GHFWVGDELYCEK; PSMDSEGGSLLLDEDSEVFK; SSYSSPTSLSPR; DADLRPGDIIVAINGESAEGMLHAEAQSK 1 IPI00396593.3
857 S_Total95_3865 IPI00003818.1 |SWISS-PROT:Q16719 |TREMBL:Q9BVW3; Q53SY0; Q6I9T2; Q53SX6; Q53F63 |REFSEQ_NP:NP_003928 |ENSEMBL:ENSP00000264170 |H-INV:HIT000029972 Tax_Id=9606 Kynureninase 11 IEDILEVIEK; HFRECFYIPK; VAPVPLYNSFHDVYK; FTNLLTSILDSAETKN; FTNLLTSILDSAETK; IQDLPPVDLSLVNK; PALVGWFGHELSTR; IQDLPPVDLSLVNKDENAIYFLGNSLGLQPK; RPWITGDESIVGLMK; VALHLDEEDKLR; KPVVNIITPSHVEER 1 IPI00003818.1
858 S_Total95_3895 IPI00477981.1 |ENSEMBL:ENSP00000349584 Tax_Id=9606 56 kDa protein 11 ISLTQAGLEALFESNLLDDLK; IVENSDAVTEILNNAELLK; ILTLSQIGR; TIAEIFGNPNYLR; TYLSEGPYYVKPVSTTAVEGAE; GISSQPFPELHCAALK; QIVYCIGGENLSVAK; ELTGEDVLVR; FFGNLAVMDSPQQICER; LMFNSPGFVEYVVDR; VFEMIESQDPTMIGVAVDTVGILGSNVEGK 2 IPI00002134.3, IPI00477981.1
859 S_Total95_3965 IPI00329200.4 |SWISS-PROT:O00410 |TREMBL:Q9BVS9; Q5T578; Q86XC7; Q5T577 |REFSEQ_NP:NP_002262 |ENSEMBL:ENSP00000261574; ENSP00000350219 |H-INV:HIT000030454 Tax_Id=9606 Importin beta-3 11 LLSSAFDEVYPALPSDVQTAIK; NLIDEDGNNQWPEGLK; FLFDSVSSQNVGLR; SLVEIADTVPK; VSDILHSIFSSYK; ITFLLQAIR; QAEETYENIPGQSK; TKENVNATENCISAVGK; EFQQYLPVVMGPLMK; ENVNATENCISAVGK; LVLEQVVTSIASVADTAEEK 1 IPI00329200.4
860 S_Total95_4080 IPI00293616.2 |SWISS-PROT:O15523 Tax_Id=9606 DEAD-box protein 3, Y-chromosomal 11 GKIGLDFCK; HAIPIIK; LEQELFSGGNTGINFEK; SPILVATAVAAR; VGSTSENITQK; DFLDEYIFLAVGR; IVEQDTMPPK; MLDMGFEPQIR; VRPCVVYGGADIGQQIR; NDPELDQQLANLDLNSEK; NMNITKDLLDLLVEAK 2 IPI00383592.1, IPI00293616.2
861 S_Total95_4095 IPI00289776.1 |TREMBL:O75592; Q9UQ11; Q5VZN6; Q6PIB6; Q5JSX8 |REFSEQ_NP:NP_055872 |ENSEMBL:ENSP00000349892 |H-INV:HIT000008524; HIT000000633; HIT000008573; HIT000007162; HIT000001827 Tax_Id=9606 Protein associated with Myc 11 SLSPNHNTLQTLKSDGRMPSSSR; TNSLTDSTCDDSSEFK; HSLEISSALNMFNIAPHGPDISKMGSINKNK; CDAEAGRGDDYDPR; VVKTGPSGHNIRSCPNLR; PFQSQLPSVKEGISEDLPVK; SMPPSLETSPITDTDLAK; YVSVHVDNSRDLGNK; ITTYPPGSVR; NAIAETIIALTKMEEEFR; QGGPSAGKWVELPITK 1 IPI00289776.1
862 S_Total95_4215 IPI00218093.4 |TREMBL:Q6IPQ2; Q8IZW7; Q8NAD0; Q68CZ2; Q59GW4 |REFSEQ_NP:NP_073585 |ENSEMBL:ENSP00000275514 |H-INV:HIT000017731 Tax_Id=9606 Hypothetical protein DKFZp686M1045 11 AELDQLLSGFGLEDPGSSLK; AGVDYAPNLPPFPSPADVK; CPADNPGLVQAQPR; VSAQGITLTDNQR; ESMCSTPAFPVSPETPYVK; ETMTPGYPQDLDIIDGR; GVGSGPHPPDTQQPSPSK; HPPFSPPEPPLSSPASQHK; LLIPERDPLEEIAESSPQTAANSAAELLK; SCPETLTHAVGMSESPIGPK; YVQFLSGLLSGSVK 1 IPI00218093.4
863 S_Total95_4228 IPI00418234.3 |SWISS-PROT:P51608 |TREMBL:Q6QHH9; Q7Z384 |REFSEQ_NP:NP_004983 |ENSEMBL:ENSP00000301948 |H-INV:HIT000035329 Tax_Id=9606 Methyl-CpG-binding protein 2 11 AETSEGSGSAPAVPEASASPK; TQPAVATAATAAEK; VGDTSLDPNDFDFTVTGR; SPGKLLVKMPFQTSPGGK; AEGGGATTSTQVMVIK; EEKMPRGGSLESDGCPK; EVVKPLLVSTLGEK; SEDQDLQGLK; GPMYDDPTLPEGWTR; KAEADPQAIPK; KPGSVVAAAAAEAK 1 IPI00418234.3
864 S_Total95_4307 IPI00029629.2 |SWISS-PROT:Q14258 |TREMBL:Q59GW5 |REFSEQ_NP:NP_005073 |ENSEMBL:ENSP00000323889 |H-INV:HIT000037749 Tax_Id=9606 Tripartite motif protein 25 11 ASAPSPNAQVACDHCLK; FDTIYQILLK; LPTFGAPEQLVDLK; TCSPASLSQASADLEATLR; FDTIYQILLKK; VNSKFDTIYQILLK; ALLDASETTSTR; KPPPVPALPSK; NTVLCNVVEQFLQADLAR; KVEQLQQEYTEMK; PVYIPEVELNHK 1 IPI00029629.2
865 S_Total95_4393 IPI00021728.3 |SWISS-PROT:P20042 |TREMBL:Q96I16; Q6IBR8 |REFSEQ_NP:NP_003899 |ENSEMBL:ENSP00000246201 |H-INV:HIT000030014; HIT000033514; HIT000029646 Tax_Id=9606 Eukaryotic translation initiation factor 2 subunit 2 11 DASDDLDDLNFFNQK; IFDIDEAEEGVK; IYFLQCETCHSR; EVEPEPTEDKDLEADEEDTR; KIFDIDEAEEGVK; DYTYEELLNR; DDGISFSNQTGPAWAGSER; DLEADEEDTR; IESDVQEPTEPEDDLDIMLGNK; TSFVNFTDICK; FPDEDEILEKDEALEDEDNK 1 IPI00021728.3
866 S_Total95_4411 IPI00604735.1 |TREMBL:Q53EN1 |H-INV:HIT000009809 Tax_Id=9606 Tyrosyl-tRNA synthetase variant 11 DFAAEVVHPGDLK; VDAQFGGIDQR; AFCEPGNVENNGVLSFIK; NSEPEEVIPSR; TVVSGLVQFVPK; NLQEVLGEEK; ISEECIAQWK; LVVVLCNLKPQK; LASAAYPDPSK; NSVEVALNK; QVEPLDPPAGSAPGEHVFVK 2 IPI00007074.4, IPI00604735.1
867 S_Total95_4438 IPI00002245.3 |TREMBL:Q8NC66; Q9H6R3 |REFSEQ_NP:NP_078836 |ENSEMBL:ENSP00000261206 |H-INV:HIT000008890; HIT000015047; HIT000034277; HIT000037312 Tax_Id=9606 Hypothetical protein FLJ21963 11 DINATEEQVLEEIVK; GHVPLALCVLR; IAIIYDSPVTNTK; THFAASVTDPER; VDDVINVAGHR; LPLPPGAFSGLWK; RVEYVPLVEEALK; IGAIHSLIFGGFASK; VEYVPLVEEALK; ISAGAIEESILSHGTVADCAVVGK; ILIYNRPNMEAVPLAPGR 1 IPI00002245.3
868 S_Total95_4462 IPI00027443.4 |TREMBL:Q5HYE4 |REFSEQ_NP:NP_001014437 Tax_Id=9606 Hypothetical protein DKFZp686F1612 11 DNILPELGVR; IQHAVQLATEPLEK; ALQEGEGDLSISADR; PFSVKLNETTDPDK; DTLDYSSNTMESALQYEK; DLLSDWLDSTLGCDVTDNSIFSK; IPPSEMFLSETDK; VPEILQLSDALR; LTGEEVNSCVEVLLEEAK; LAFLMHSWKDTLDYSSNTMESALQYEK; SYVQGYSLSQADVDAFRQLSAPPADPQLFHVAR 1 IPI00027443.4
869 S_Total95_4640 IPI00218922.4 |SWISS-PROT:Q9UGP8 |TREMBL:Q5THN4 |REFSEQ_NP:NP_009145 |ENSEMBL:ENSP00000027474 |H-INV:HIT000025626; HIT000003939 Tax_Id=9606 Translocation protein SEC63 homolog 11 EQSICAAEEQPAEDGQGETNK; VLLLSHLAR; AYAALTDEESR; KKPTPVLLPQSK; LSQMAVQGLQQFK; YKIKTIQDLVSLK; DDEAEWQELQQSIQR; ITHPVYSLYFPEEK; SDSYMGLDQIKPLK; EYQEYNPYEVLNLDPGATVAEIK; DATSRPTDNILIPQLIREIGSINLK 1 IPI00218922.4
870 S_Total95_4777 IPI00029012.1 |SWISS-PROT:Q14152 |TREMBL:Q5T5X0; Q15778; Q7Z5T5; Q6P1R0 |REFSEQ_NP:NP_003741 |ENSEMBL:ENSP00000263141 |H-INV:HIT000042275 Tax_Id=9606 Eukaryotic translation initiation factor 3 subunit 10 11 FNVLQYVVPEVK; LLQQVSQIYQSIEFSR; LTSLVPFVDAFQLER; TLSFGSDLNYATR; AVEDIHGLFSLSK; KERLESLNIQR; DIDIEDLEELDPDFIMAK; DLYNWLEVEFNPLK; NQLTAMSSVLAKALEVIK; EQPEKEPELQQYVPQLQNNTILR; EESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDR 1 IPI00029012.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home