Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
61 S_Total95_481 IPI00554648.1 |SWISS-PROT:P05787 Tax_Id=9606 Keratin, type II cytoskeletal 8 37 ASLEAAIADAEQR; EYQELMNVK; LEGLTDEINFLR; LQAEIEGLK; LSELEAALQR; SLDMDSIIAEVK; YEELQSLAGK; AEAESMYQIK; DVDEAYMNK; NKYEDEINKR; LEAELGNMQGLVEDFK; LESGMQNMSIHTK; LVSESSDVLPK; SNMDNMFESYINNLR; LALDIEIATYR; AQYEDIANR; TEMENEFVLIK; WSLLQQQK; DVDEAYMNKVELESR; TEMENEFVLIKK; TLNNKFASFIDKVR; RQLETLGQEK; FASFIDK; ASLEAAIADAEQRGELAIK; DGKLVSESSDVLPK; QLYEEEIR; LKLEAELGNMQGLVEDFK; TLNNKFASFIDK; ELQSQISDTSVVLSMDNSR; KLLEGEESR; GGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVR; QLYEEEIRELQSQISDTSVVLSMDNSR; SRAEAESMYQIK; LQAEIEGLKGQR; FASFIDKVR; LALDLEIATYR; PMF; Comb 1 IPI00554648.1
62 S_Total95_546 IPI00012728.1 |SWISS-PROT:P33121-1 |REFSEQ_NP:NP_001986 |ENSEMBL:ENSP00000281455; ENSP00000352975 Tax_Id=9606 Splice Isoform 1 of Long-chain-fatty-acid--CoA ligase 1 37 LLLEGVENK; DSGLKPFEQVK; KPDQPYEWLSYK; LAQGEYIAPEK; NIVSDCSAFVK; SQIDDLYSTIK; SQIDDLYSTIKV; VLQPTVFPVVPR; GFEGSFEELCR; GIQVSNNGPCLGSR; IGFFQGDIR; SALLDSDEPLVYFYDDVTTLYEGFQR; AELSLVFVDKPEK; DGWLHTGDIGK; IFGQANTTLK; KPKPPAPEDLAVICFTSGTTGNPK; LMVTGAAPVSATVLTFLR; IFGQANTTLKR; QVAELSECIGSALIQK; WLLDFASK; IENIYMR; AILEDMVR; IIVVMDAYGSELVER; MPELVDFR; VVECVMLCHGAK; GITLHPELFSIDNGLLTPTMK; TAEALDKDGWLHTGDIGK; ATENTVNPCPDDTLISFLPLAHMFER; PLKPPCDLSMQSVEVAGSGGAR; PKPLKPPCDLSMQSVEVAGSGGAR; PKPPAPEDLAVICFTSGTTGNPK; LGKDSGLKPFEQVK; GPNVFKGYLK; GPNVFQGYLK; GPNVFQGYLKDPAK; LVDVEEMNYMAAEGEGEVCVK; PMF; Comb 1 IPI00012728.1
63 S_Total95_145 IPI00473031.5 |SWISS-PROT:P00325 |TREMBL:Q4ZGI9 |REFSEQ_NP:NP_000659 |ENSEMBL:ENSP00000306606 |H-INV:HIT000041758 Tax_Id=9606 Alcohol dehydrogenase beta chain 36 FSLDALITHVLPFEK; IIAVDINK; INEGFDLLHSGK; KPFSIEDVEVAPPK; ELGATECINPQDYK; VIPLFTPQCGK; IIAVDINKDK; NPESNYCLK; IDAASPLEK; AAVLWEVK; EMTDGGVDFSFEVIGR; KFSLDALITHVLPFEK; KPIQEVLK; VCLIGCGFSTGYGSAVNVAK; VTPGSTCAVFGLGGVGLSAVMGCK; IIAVDINKDKFAK; AKELGATECINPQDYK; GKPIHHFLGTSTFSQYTVVDENAVAK; LVADFMAK; NPESNYCLKNDLGNPR; ELGATECINPQDYKK; IKMVAVGICR; PFSIEDVEVAPPK; VCKNPESNYCLK; AKELGATECINPQDYKK; PIQEVLK; MVAVGICR; PIQEVLKEMTDGGVDFSFEVIGR; GAVYGGFK; GTLQDGTR; PIHHFLGTSTFSQYTVVDENAVAK; IDAASPLEKVCLIGCGFSTGYGSAVNVAK; INEGFDLLHSGKSIRTVLTF; SDEHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDK; ELGATECINPQDYKKPIQEVLK; Comb; PMF 1 IPI00473031.5
64 S_Total95_765 IPI00295388.2 |SWISS-PROT:P23378 |TREMBL:Q5VYQ9; Q9HDA3 |REFSEQ_NP:NP_000161 Tax_Id=9606 OTTHUMP00000044451 36 SANIEAVDVAK; YTGVLTELK; VEDFTELVER; LNSSSELAPITWK; DVSGVLFQYPDTEGK; LPCEMDFSGK; AGHQLQHDLFFDTLK; DVSGVLFQYPDTEGKVEDFTELVER; EFANIHPFVPLDQAQGYQQLFR; FGVPLGYGGPHAAFFAVR; GYVGHEFILDTR; HLAPFLPNHPVISLK; IQPVEVDKYGNIDAVHLK; LFEDGTLGISLDETVNEK; NLLENSGWITQYTPYQPEVSQGR; TSPFLTHQVFNSYHSETNIVR; VHNATLILSEGLK; VHNATLILSEGLKR; YGNIDAVHLK; EMLQTLGLASIDELIEK; SYIGMGYYNCSVPQTILR; TFCIPHGGGGPGMGPIGVK; CHPQTIAVVQTR; EVAAFPLPFVKPENK; QATETAILNANYMAK; QEIADIEEGR; RVHNATLILSEGLK; MEDPVCENEILATLHAISSK; FCDAMISIR; PGDFGSDVSHLNLHK; YTGVLTELKLPCEMDFSGK; MEDPVCENEILATLHAISSKNQIWR; LQDYGFHAPTMSWPVAGTLMVEPTESEDK; SAHGTNPASAHMAGMK; IDDIYGDQHLVCTCPPMEVYESPFSEQK; Comb; PMF 1 IPI00295388.2
65 S_Total95_148 IPI00470525.2 |SWISS-PROT:P06737 |TREMBL:Q6P1L4; Q641R5; Q501V9 |REFSEQ_NP:NP_002854 |ENSEMBL:ENSP00000216392 Tax_Id=9606 GlycoGen phosphorylase, liver 35 DFSELEPDKFQNK; EYYEALPELK; FSQFLETEYK; VFADYEAYVK; IFVDIEK; VLYPNDNFFEGK; LVIDQIDNGFFSPK; YEYGIFNQK; WPVDLVEK; DFNVGDYIQAVLDR; DYYFALAHTVR; GIVGVENVAELKK; EYAQNIWNVEPSDLK; HLEIIYEINQK; ISLSNESNKVNGN; LHSFLGDDVFLR; LKQEYFVVAATLQDIIR; RWLLLCNPGLAELIAEK; TFAYTNHTVLPEALER; VIFLENYR; WLLLCNPGLAELIAEK; DGWQVEEADDWLR; INMAHLCIVGSHAVNGVAK; INPSSMFDVQVKR; GIVGVENVAELK; LITSVADVVNNDPMVGSK; VIPATDLSEQISTAGTEASGTGNMK; DIINMLFYHDR; SRPEFMLPVHFYGK; VSQLYMNPK; MSLIEEEGSK; INPSSMFDVQVK; QEYFVVAATLQDIIR; LAACFLDSMATLGLAAYGYGIR; PMF; Comb 1 IPI00470525.2
66 S_Total95_385 IPI00001441.3 |SWISS-PROT:O95954-1 |TREMBL:Q86V03 |REFSEQ_NP:NP_996848; NP_006648 |ENSEMBL:ENSP00000291670 Tax_Id=9606 Splice Isoform A of Formimidoyltransferase-cyclodeaminase 35 ALLDAAAFYCEK; ENLFILEEEQR; LGLDSLCPFSPK; VQGIGWYLDEK; IIEYLVPER; AGEYEALPK; AFVGEVGAR; EAQELSLPVVGSQLVGLVPLK; LAEELDVPVYLYGEAAR; SAAPGGGSVAAAAAAMGAALGSMVGLMTYGR; TVYTFVGPPECVVEGALNAAR; GVSVDECVLCAQAFGQR; KLQQADWAPDFGPSSFVPSWGATATGAR; MGALDVCPFIPVR; NLAQVSTNLLDFEVTALHTVYEETCR; KVQGIGWYLDEK; LQQADWAPDFGPSSFVPSWGATATGAR; QFQSLDTTMR; FLIAFNINLLGTK; NQEVIDAISGAITQTPGCVLLDVDAGPSTNR; TVYTFVGPPECVVEGALNAARVASRLIDMSR; KFLIAFNINLLGTK; IIEYLVPERGPER; DITDEAFK; TAALQEGLR; AVSVPLTLAETVASLWPALQELAR; LTTLVDADAEAFTAYLEAMR; RTAALQEGLR; SDLQVAAK; TQAALVLDCLETR; DITDEAFKDQIHHR; TQAALVLDCLETRQE; VSSLLQEAK; HQGEHPR; PMF; Comb 1 IPI00001441.3
67 S_Total95_752 IPI00307162.2 |SWISS-PROT:P18206-1 |TREMBL:Q5JQ13 |REFSEQ_NP:NP_054706 |ENSEMBL:ENSP00000211998 |H-INV:HIT000027042 Tax_Id=9606 Vinculin isoform meta-VCL 35 AVAGNISDPGLQK; SLGEISALTSK; AQQVSQGLDVLTAK; AIPDLTAPVAAVQAAVSNLVR; ALASQLQDSLK; CDRVDQLTAQLADLAAR; DPSASPGDAGEQAIR; EAFQPQEPDFPPPPPDLEQLR; ETVQTTEDQILK; QVATALQNLQTK; STVEGIQASVK; VDQLTAQLADLAAR; VLQLTSWDEDAWASK; ELLPVLISAMK; ELTPQVVSAAR; SLLDASEEAIK; SLLDASEEAIKK; VAMANIQPQMLVAGATSIAR; WIDNPTVDDR; GEGESPQARALASQLQDSLK; TNLLQVCER; IAELCDDPK; GILSGTSDLLLTFDEAEVR; MTGLVDEAIDTK; LLAVAATAPPDAPNR; MLGQMTDQVADLR; MSAEINEIIR; NQWIDNVEK; SFLDSGYR; MQEAMTQEVSDVFSDTTTPIK; KIDAAQNWLADPNGGPEGEEQIR; LTDELAPPKPPLPEGEVPPPRPPPPEEK; TNISDEESEQATEMLVHNAQNLMQSVK; ALASQLQDSLKDLK; Comb; PMF 1 IPI00307162.2
68 S_Total95_1220 IPI00221226.6 |SWISS-PROT:P08133 |REFSEQ_NP:NP_001146 |ENSEMBL:ENSP00000346550 |H-INV:HIT000037805 Tax_Id=9606 Annexin A6 35 DAFVAIVQSVK; ALLALCGGED; SEIDLLNIR; EAILDIITSR; NKPLFFADK; EDAQVAAEILEIADTPSGDK; GFGSDKEAILDIITSR; SLEDALSSDTSGHFR; ALIEILATR; ILISLATGHR; RVFQEFIK; SLHQAIEGDTSGDFLK; MTNYDVEHTIKK; MTNYDVEHTIK; DLMTDLK; GSIHDFPGFDPNQDAEALYTAMK; IMVSRSEIDLLNIR; EDAQVAAEILEIADTPSGDKTSLETR; DLIADLK; DAISGIGTDEK; DLEADIIGDTSGHFQK; GLGTDEDTIIDIITHR; EEDDVVSEDLVQQDVQDLYEAGELK; GTVRPANDFNPDADAK; WGTDEAQFIYILGNR; YELTGKFER; SELDMLDIR; MLVVLLQGTR; TTGKPIEASIR; CLIEILASR; PANDFNPDADAK; TNEQMHQLVAAYK; LIVGLMRPPAYCDAK; LVFDEYLK; Comb; PMF 1 IPI00221226.6
69 S_Total95_1546 IPI00216164.2 |SWISS-PROT:Q08426 |TREMBL:Q58EZ5 |REFSEQ_NP:NP_001957 |ENSEMBL:ENSP00000231887 Tax_Id=9606 Peroxisomal bifunctional enzyme 35 LHNALALIR; NPPVNAISTTLLR; CLYSLINEAFR; LTGVPAALDLITSGR; YCPIPDVLCELGR; TISQDEILER; VSDLAGLDVGWK; VVNSDPVEEAIR; EWQSLAGSPSSK; AVQAAVQYPYEVGIK; GQGLTGPTLLPGTPAR; GWYQYDKPLGR; KGQGLTGPTLLPGTPAR; ALQYAFFAER; EEELFLYLLQSGQAR; IGVVVGNCFGFVGNR; LLEVIPSQYSSPTTIATVMNLSK; LTGVPAALDLITSGRR; QNPDIPQLEPSDYLK; AIVICGAEGK; LASQGNPPLK; LASQGNPPLKEWQSLAGSPSSK; QNPDIPQLEPSDYLKK; VSDQPLESR; ELGGVDLVIEAVFEEMSLK; KEEELFLYLLQSGQAR; LRNPPVNAISTTLLR; GGPMFYASTVGLPTVLEK; PVSSVGVVGLGTMGR; MQQSGHPWSGPKPR; PIQSLPNMDSIFSEALLK; LCNKPIQSLPNMDSIFSEALLK; RQHPGCLAQEACVR; KLASQGNPPLKEWQSLAGSPSSK; Comb 1 IPI00216164.2
70 S_Total95_2433 IPI00296645.3 |SWISS-PROT:P55157 |REFSEQ_NP:NP_000244 |ENSEMBL:ENSP00000265517 Tax_Id=9606 Microsomal triglyceride transfer protein large subunit precursor 35 NALLPEGIPSLLK; DVNVENVNQQR; SGFTTPNQVLGVSSK; SGSSSAYTGYIER; SNLNIFQYIGK; KEEILQILK; YDLPFITDEVK; NFLAFIQHLR; YAEAGEGPISHLATTALQR; YDLPFITDEVKK; EFYSYQNEAVAIENIK; VVFAPQPDSTSSGWF; LTYSTEVLLDR; SDSSIILQER; YMLAIVQDILR; NILLSIGELPQEMNK; RSNLNIFQYIGK; SASTYSLDILYSGSGILR; VKEFYSYQNEAVAIENIK; YTAIPIVGQVFQSHCK; TAAAAIILNNNPSYMDVK; ALDSCKIAR; ETVMIITGTLVR; MLSASGDPISVVK; KYLQPDNLSK; NPDGDDDQLIQITMK; PTLLHLIHGK; ISSNVDVALLWR; VTVVITTDITVDSSFVK; EVLPQLVDAVTSAQTSDSLEAILDFLDFK; GLASLFQTQLSSGTTNEVDISGNCK; TAKKEEILQILK; ENLEALQRPTLLHLIHGK; GLILLIDHSQELQLQSGLK; IEDSFVIAVLAEETHNFGLNFLQTIK 2 IPI00296645.3, IPI00478040.1
71 S_Total95_175 IPI00010796.1 |SWISS-PROT:P07237 |TREMBL:Q96C96 |REFSEQ_NP:NP_000909 |ENSEMBL:ENSP00000327801 |H-INV:HIT000035078; HIT000040847 Tax_Id=9606 Protein disulfide-isomerase precursor 34 EADDIVNWLK; ENLLDFIK; ILEFFGLK; NFEDVAFDEK; PESEELTAER; THILLFLPK; YKPESEELTAER; YQLDKDGVVLFK; NFEDVAFDEKK; NNFEGEVTK; MDSTANEVEAVK; LITLEEEMTK; HNQLPLVIEFTEQTAPK; ILFIFIDSDHTDNQR; LGETYKDHENIVIAK; QFLQAAEAIDDIPFGITSNSDVFSK; TGPAATTLPDGAAAESLVESSEVAVIGFFK; VDATEESDLAQQYGVR; NNFEGEVTKENLLDFIK; ILEFFGLKK; DGVVLFK; TVIDYNGER; RTGPAATTLPDGAAAESLVESSEVAVIGFFK; IKPHLMSQELPEDWDK; TAAESFKGKILFIFIDSDHTDNQR; FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK; VDATEESDLAQQYGVRGYPTIK; IKPHLMSQELPEDWDKQPVK; DHENIVIAK; QLAPIWDK; SNFAEALAAHK; KSNFAEALAAHK; YLLVEFYAPWCGHCK; PMF; Comb 1 IPI00010796.1
72 S_Total95_374 IPI00017855.1 |SWISS-PROT:Q99798 |TREMBL:Q5JZ41 |REFSEQ_NP:NP_001089 |ENSEMBL:ENSP00000216254 |H-INV:HIT000036514 Tax_Id=9606 Aconitate hydratase, mitochondrial precursor 34 DGYAQILR; NTIVTSYNR; SQFTITPGSEQIR; LQLLEPFDK; CTTDHISAAGPWLK; DINQEVYNFLATAGAK; DLEDLQILIK; EDIANLADEFK; FNPETDYLTGTDGK; FNPETDYLTGTDGKK; FRLEAPDADELPK; GEFDPGQDTYQHPPK; GHLDNISNNLLIGAINIENGK; IVYGHLDDPASQEIER; LTGSLSGWSSPK; NAVTQEFGPVPDTAR; NDANPETHAFVTSPEIVTALAIAGTLK; QGLLPLTFADPADYNK; WVVIGDENYGEGSSR; IHPVDKLTIQGLK; LNRPLTLSEK; TGREDIANLADEFK; VAMQDATAQMAMLQFISSGLSK; DSSGQHVDVSPTSQR; EGWPLDIR; RLNRPLTLSEK; WDGKDLEDLQILIK; LEAPDADELPK; VGLIGSCTNSSYEDMGR; AKDINQEVYNFLATAGAK; LTIQGLKDFTPGKPLK; VAMSHFEPNEYIHYDLLEK; DLGGIVLANACGPCIGQWDR; PMF; Comb 1 IPI00017855.1
73 S_Total95_375 IPI00550717.2 |TREMBL:Q71UF1; Q8TAQ6; Q6FHX0 |H-INV:HIT000040142 Tax_Id=9606 ACO2 protein 34 DGYAQILR; NTIVTSYNR; SQFTITPGSEQIR; LQLLEPFDK; CTTDHISAAGPWLK; DINQEVYNFLATAGAK; DLEDLQILIK; EDIANLADEFK; FNPETDYLTGTDGK; FNPETDYLTGTDGKK; FRLEAPDADELPK; GEFDPGQDTYQHPPK; GHLDNISNNLLIGAINIENGK; IVYGHLDDPASQEIER; LTGSLSGWSSPK; NAVTQEFGPVPDTAR; NDANPETHAFVTSPEIVTALAIAGTLK; QGLLPLTFADPADYNK; WVVIGDENYGEGSSR; IHPVDKLTIQGLK; LNRPLTLSEK; TGREDIANLADEFK; VAMQDATAQMAMLQFISSGLSK; DSSGQHVDVSPTSQR; DLGGIVPANACGPCIGQWDRK; EGWPLDIR; RLNRPLTLSEK; WDGKDLEDLQILIK; LEAPDADELPK; VGLIGSCTNSSYEDMGR; AKDINQEVYNFLATAGAK; LTIQGLKDFTPGKPLK; VAMSHFEPNEYIHYDLLEK; PMF; Comb 1 IPI00550717.2
74 S_Total95_630 IPI00034308.2 |SWISS-PROT:Q9UL12 |TREMBL:Q5SYV1; O95173; Q53F87; Q5SYV0; O96023 |REFSEQ_NP:NP_009032 |ENSEMBL:ENSP00000302152 |H-INV:HIT000018661 Tax_Id=9606 Sarcosine dehydrogenase, mitochondrial precursor 34 AIDSLSIEK; AILQEVLDADLSNEAFPFSTHK; FYLVGLDAR; TIAYGYIHDPSGGPVSLDFVK; ADFGFAIDK; GGTESDLTVSR; VPMFGLEAIWR; MGVTYGAQAHLK; HWHADLRPDDSPLEAGLAFTCK; GAQVIENCPVTGIR; AYGVESHVLSPAETK; GPAPVLEYDYYGAYGSR; NYSVVFPHDEPLAGR; VWTDDFGVR; DHDASVYLR; DPLHEELLGQGCVFQER; LGMSGAVLLER; LQGDALSVGGYEANPIFWEEVSDK; IEGIQNMPNVR; EGQGTSVVAQGPSR; GAAAVFDMSYFGK; VPLVAMHHAYVVTER; FHHSLTDHPR; PGWFHPR; RDPLHEELLGQGCVFQER; EGQGTSVVAQGPSRPLPSTANVVVIGGGSLGCQTLYHLAK; ELEEETGLHTGWIQNGGLFIASNR; VAGVETQHGSIQTPCVVNCAGVWASAVGR; FAFGLFDLDWEVFTQHIEGAINR; TLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLAR; STVCGPESFTPDHKPLMGEAPELR; PSDVEVELLAHTR; AHEDYAYR; PMF; Comb 1 IPI00034308.2
75 S_Total95_1221 IPI00002459.3 |REFSEQ_NP:NP_004024 |ENSEMBL:ENSP00000348889 Tax_Id=9606 Annexin VI isoform 2 34 DAFVAIVQSVK; ALLALCGGED; SEIDLLNIR; EAILDIITSR; NKPLFFADK; GFGSDKEAILDIITSR; SLEDALSSDTSGHFR; ALIEILATR; ILISLATGHR; RVFQEFIK; SLHQAIEGDTSGDFLK; MTNYDVEHTIKK; MTNYDVEHTIK; DLMTDLK; GSIHDFPGFDPNQDAEALYTAMK; IMVSRSEIDLLNIR; DLIADLK; DAISGIGTDEK; DLEADIIGDTSGHFQK; GLGTDEDTIIDIITHR; EEDDVVSEDLVQQDVQDLYEAGELK; GTVRPANDFNPDADAK; WGTDEAQFIYILGNR; YELTGKFER; SELDMLDIR; MLVVLLQGTR; CLIEILASR; PANDFNPDADAK; TNEQMHQLVAAYK; LIVGLMRPPAYCDAK; LVFDEYLK; EDAQEIADTPSGDK; EDAQEIADTPSGDKTSLETR; PMF; Comb 1 IPI00002459.3
76 S_Total95_69 IPI00219526.5 |SWISS-PROT:P36871-1 |TREMBL:Q86U74; Q9H1D2; Q6NW22; Q5BKZ9 |REFSEQ_NP:NP_002624 |ENSEMBL:ENSP00000006941 |H-INV:HIT000038719 Tax_Id=9606 Phosphoglucomutase 1 33 EAIQLIAR; IALYETPTGWK; TIEEYAVCPDLK; YDYEEVEAEGANK; DLEALMFDR; VDLGVLGK; ADNFEYSDPVDGSISR; FNISNGGPAPEAITDK; VFQSSANYAENFIQSIISTVEPAQR; AIGGIILTASHNPGGPNGDFGIK; LSGTGSAGATIR; LVIGQNGILSTPAVSCIIR; ICIDAMHGVVGPYVKK; INQDPQVMLAPLISIALK; LSLCGEESFGTGSDHIR; LYIDSYEK; LYIDSYEKDVAK; SGEHDFGAAFDGDGDR; SIFDFSALK; TQAYQDQKPGTSGLR; KQSVEDILK; QEATLVVGGDGR; IAAANGIGR; LIFTDGSR; QFSANDKVYTVEK; HGFFVNPSDSVAVIAANIFSIPYFQQTGVR; FNISNGGPAPEAITDKIFQISK; DVAKINQDPQVMLAPLISIALKVSQLQER; ILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMK; FFGNLMDASK; DGLWAVLAWLSILATR; PMF; IVTVKTQAYQDQKPGTSGLR; Comb 1 IPI00219526.5
77 S_Total95_96 IPI00003362.1 |SWISS-PROT:P11021 |TREMBL:Q9UK02 |REFSEQ_NP:NP_005338 |ENSEMBL:ENSP00000265959 |H-INV:HIT000038771 Tax_Id=9606 78 kDa glucose-regulated protein precursor 33 NELESYAYSLK; ELEEIVQPIISK; LYGSAGPPPTGEEDTAEKDEL; LYGSAGPPPTGEEDTAEK; ITPSYVAFTPEGER; KSDIDEIVLVGGSTR; MKETAEAYLGK; SDIDEIVLVGGSTR; TWNDPSVQQDIK; TFAPEEISAMVLTK; VEIIANDQGNR; DAGTIAGLNVMR; FEELNMDLFR; NQLTSNPENTVFDAK; IINEPTAAAIAYGLDK; DNHLLGTFDLTGIPPAPR; SQIFSTASDNQPTVTIK; VTHAVVTVPAYFNDAQR; IEIESFYEGEDFSETLTR; IEWLESHQDADIEDFK; IINEPTAAAIAYGLDKR; TKPYIQVDIGGGQTK; KSQIFSTASDNQPTVTIK; EFFNGKEPSR; AKFEELNMDLFR; EDVGTVVGIDLGTTYSCVGVFK; GVPQIEVTFEIDVNGILR; AVEEKIEWLESHQDADIEDFK; ITITNDQNR; LTPEEIER; NQLTSNPENTVFDAKR; VEILANDQGNR; PMF; Comb 1 IPI00003362.1
78 S_Total95_224 IPI00031522.2 |SWISS-PROT:P40939 |TREMBL:Q53TA2; Q9UQC5; Q53T69 |REFSEQ_NP:NP_000173 |ENSEMBL:ENSP00000288682 |H-INV:HIT000034217 Tax_Id=9606 Trifunctional enzyme alpha subunit, mitochondrial precursor 33 DTSASAVAVGLK; GFYIYQEGVK; SEVSSDEDIQFR; FGGGNPELLTQMVSK; DATLTALDR; FVDLYGAQK; DLNSDMDSILASLK; GLYPAPLK; TGIEQGSDAGYLCESQK; TLQEVTQLSQEAQR; TVLGTPEVLLGALPGAGGTQR; KQTKGLYPAPLK; DSIFSNLTGQLDYQGFEK; EVEAVIPDHCIFASNTSALPISEIAAVSK; KLDSLTTSFGFPVGAATLVDEVGVDVAK; MQLLEIITTEK; VIGMHYFSPVDK; ALMGLYHGQVLCKK; HLAILGAGLMGAGIAQVSVDK; KTVLGTPEVLLGALPGAGGTQR; TIEYLEEVAITFAK; DGPGFYTTR; PGCFIAGADINMLAACK; ADMVIEAVFEDLSLK; ELHSEFSEVMNEIWASDQIR; LDSLTTSFGFPVGAATLVDEVGVDVAK; ALMGLYHGQVLCK; FGELVMTK; MVGVPAALDMMLTGR; KDLNSDMDSILASLK; MGLVDQLVEPLGPGLKPPEER; STKPIVAAINGSCLGGGLEVAISCQYR; Comb; PMF 1 IPI00031522.2
79 S_Total95_231 IPI00022774.2 |SWISS-PROT:P55072 |TREMBL:Q9HAP1; Q5VYM0 |REFSEQ_NP:NP_009057 |ENSEMBL:ENSP00000298001 |H-INV:HIT000001855 Tax_Id=9606 Transitional endoplasmic reticulum ATPase 33 DVDLEFLAK; GVLFYGPPGCGK; LEILQIHTK; EVDIGIPDATGR; LGDVISIQPCPDVK; GLLLYGPPGTGK; MDELQLFR; ELQELVQYPVEHPDK; NAPAIIFIDELDAIAPK; EDEEESLNEVGYDDIGGCR; LDQLIYIPLPDEK; LIVDEAINEDNSVVSLSQPK; QAAPCVLFFDELDSIAK; WALSQSNPSALR; EAVCIVLSDDTCSDEK; ETVVEVPQVTWEDIGGLEDVK; GDDLSTAILK; ETVVEVPQVTWEDIGGLEDVKR; GILLYGPPGTGK; AIANECQANFISIK; MTNGFSGADLTEICQR; IVSQLLTLMDGLK; VINQILTEMDGMSTK; NVFIIGATNRPDIIDPAILR; QTNPSAMEVEEDDPVPEIR; NVFIIGATNRPDIIDPAILRPGR; LADDVDLEQVANETHGHVGADLAALCSEAALQAIR; VVETDPSPYCIVAPDTVIHCEGEPIKR; MDLIDLEDETIDAEVMNSLAVTMDDFR; VVETDPSPYCIVAPDTVIHCEGEPIK; KGDIFLVR; THGEVERR; PMF; Comb 1 IPI00022774.2
80 S_Total95_360 IPI00016801.1 |SWISS-PROT:P00367 |TREMBL:Q9UQV0; Q53GW3; Q5TBU3; Q14400 |REFSEQ_NP:NP_005262 |ENSEMBL:ENSP00000277865 |H-INV:HIT000019637 Tax_Id=9606 Glutamate dehydrogenase 1, mitochondrial precursor 33 YSTDVSVDEVK; CAVVDVPFGGAK; LQHGSILGFPK; GFIGPGIDVPAPDMSTGER; TFVVQGFGNVGLHSMR; AKPYEGSILEADCDILIPAASEK; ALASLMTYK; CIAVGESDGSIWNPDGIDPK; NYTDNELEK; PYEGSILEADCDILIPAASEK; KGFIGPGIDVPAPDMSTGER; PISQGGIHGR; GVFHGIENFINEASYMSILGMTPGFGDK; FTMELAK; DDGSWEVIEGYR; IIAEGANGPTTPEADK; RDDGSWEVIEGYR; TAAYVNAIEK; YNLGLDLR; IIAEGANGPTTPEADKIFLER; IIKPCNHVLSLSFPIR; MVEGFFDR; PCNHVLSLSFPIR; DIVHSGLAYTMER; HGGTIPIVPTAEFQDR; DSNYHLLMSVQESLER; VYNEAGVTFT; GASIVEDKLVEDLR; NIMVIPDLYLNAGGVTVSYFEWLK; QIMRTAMKYNLGLDLR; ISGASEKDIVHSGLAYTMER; NLNHVSYGR; Comb; PMF 1 IPI00016801.1
81 S_Total95_822 IPI00007765.5 |SWISS-PROT:P38646 |TREMBL:Q8N1C8; Q6GU03; Q53H23 |REFSEQ_NP:NP_004125 |ENSEMBL:ENSP00000297185 |H-INV:HIT000039734; HIT000029662 Tax_Id=9606 Stress-70 protein, mitochondrial precursor 33 AQFEGIVTDLIR; DAGQISGLNVLR; EQQIVIQSSGGLSK; VQQTVQDLFGR; QAVTNPNNTFYATK; TTPSVVAFTADGER; DDIENMVK; LLGQFTLIGIPPAPR; VINEPTAAALAYGLDK; SQVFSTAADGQTQVEIK; NAVITVPAYFNDSQR; STNGDTFLGGEDFDQALLR; MEEFKDQLPADECNK; MISASRAAAARLVGAAASR; QAASSLQQASLK; VLENAEGAR; YDDPEVQK; ETAENYLGHTAK; LYSPSQIGAFVLMK; SDIGEVILVGGMTR; VIAVYDLGGGTFDISILEIQK; ASNGDAWVEAHGK; GVPQIEVTFDIDANGIVHVSAK; GAVVGIDLGTTNSCVAVMEGK; VEAVNMAEGIIHDTETK; CELSSSVQTDINLPYLTMDSSGPK; DQLPADECNK; LFEMAYK; RYDDPEVQK; MKETAENYLGHTAK; SEDKVIAVYDLGGGTFDISILEIQK; ERVEAVNMAEGIIHDTETK; PMF; Comb 1 IPI00007765.5
82 S_Total95_1092 IPI00011454.1 |SWISS-PROT:Q14697-2 |REFSEQ_NP:NP_938149 |ENSEMBL:ENSP00000278885 Tax_Id=9606 Splice Isoform 2 of Neutral alpha-glucosidase AB precursor 33 KLVAIVDPHIK; NPEPELLVR; DENSVELTMAEGPYK; FGAVWTGDNTAEWDHLK; AEKDEPGAWEETFK; DLGIFWLNAAETWVDISSNTAGK; FRIDELEPR; FSFSGNTLVSSSADPEGHFETPIWIER; GLLEFEHQR; LDLLEDR; LSFQHDPETSVLVLR; SIRPGLSPYR; SLLLSVNAR; VVIIGAGKPAAVVLQTK; YSLLPFWYTLLYQAHR; LVAIVDPHIK; QYASLTGTQALPPLFSLGYHQSR; DPAEGDGAQPEETPR; VTEGGEPYR; VPDVLVADPPIAR; VLLVLELQGLQK; DAQHYGGWEHR; MMDYLQGSGETPQTDVR; REPWLLPSQHNDIIR; HHGPQTLYLPVTLSSIPVFQR; PAAVVLQTK; DGSDYEGWCWPGSAGYPDFTNPTMR; EPWLLPSQHNDIIR; KPGINVASDWSIHLR; YRVPDVLVADPPIAR; VNLTLGSIWDK; QGSKDPAEGDGAQPEETPR; Comb; PMF 1 IPI00011454.1
83 S_Total95_1498 IPI00009896.1 |SWISS-PROT:P07099 |TREMBL:Q5VTJ8; Q5VTJ6; Q5VTJ7; Q6FGZ3 |REFSEQ_NP:NP_000111 |ENSEMBL:ENSP00000272167 |H-INV:HIT000033702; HIT000031605 Tax_Id=9606 Epoxide hydrolase 1 33 DVELLYPVK; FLSVLER; IIPLLTDPK; KFLSVLER; YLEDGGLER; FSLDDLLTNVMLYWTTGTIISSQR; FSTWTNTEFR; GGHFAAFEEPELLAQDIR; VETSDEEIHDLHQR; VYVPTGFSAFPFELLHTPEK; EETLPLEDGWWGPGTR; FLGLTER; FTPPLEDSCFHYGFNSNYLK; IEGLDIHFIHVKPPQLPAGHTPK; NHGLSDEHVFEVICPSIPGYGFSEASSK; TKIEGLDIHFIHVKPPQLPAGHTPK; DKEETLPLEDGWWGPGTR; EDDSIRPFK; KFLSVLERQ; NEFDWKK; DVELLYPVKEK; ENLGQGWMTQK; GFNSVATAR; PLLMVHGWPGSFYEFYK; PPQLPAGHTPK; IEGLDIHFIHVK; EDDSIRPFKVETSDEEIHDLHQR; KFSLDDLLTNVMLYWTTGTIISSQR; ESGYMHIQCTKPDTVGSALNDSPVGLAAYILEK; VFYSLMR; LISYSYMVR; GLHLNMALVLSNFSTLTLLLGQR; Comb; PMF 1 IPI00009896.1
84 S_Total95_1673 IPI00009342.1 |SWISS-PROT:P46940 |TREMBL:Q96PA3; Q6P1N4; Q5FWG8 |REFSEQ_NP:NP_003861 |ENSEMBL:ENSP00000268182 |H-INV:HIT000042199; HIT000011668 Tax_Id=9606 Ras GTPase-activating-like protein IQGAP1 33 LIFQMPQNK; TALQEEIK; EELQSGVDAANSAAQQYQR; FALGIFAINEAVESGDVGK; IFYPETTDIYDR; LAAVALINAAIQK; ATFYGEQVDYYK; FFQTACDVPELQDK; FLSAIVSSVDK; ILAIGLINEALDEGDAQK; ITLQDVVSHSK; LPYDVTPEQALAHEEVK; NVIFEISPTEEVGDFEVK; QLSSSVTGLTNIEEENCQR; QNVAYEYLCHLEEAK; SNQQLENDLNLMDIKIGLLVK; VDQIQEIVTGNPTVIK; YQELINDIAR; ALQSPALGLR; EEIQSSISGVTAAYNR; GLQQQNSDWYLK; LQQTYAALNSK; FPDAGEDELLK; SVKEDSNLTLQEK; LAAVALINAAIQKGVAEK; NKYQELINDIAR; YLDELMKLK; LEGVLAEVAQHYQDTLIR; QSGQTDPLQKEELQSGVDAANSAAQQYQR; SPDVGLYGVIPECGETYHSDLAEAK; IGGILANELSVDEAALHAAVIAINEAIDR; TLQALQIPAAKLEGVLAEVAQHYQDTLIR; Comb; PMF 1 IPI00009342.1
85 S_Total95_2556 IPI00019912.1 |SWISS-PROT:P51659 |TREMBL:Q9UBA4; Q59H27 |REFSEQ_NP:NP_000405 |ENSEMBL:ENSP00000256216 |H-INV:HIT000018906; HIT000031426 Tax_Id=9606 Peroxisomal multifunctional enzyme type 2 33 ATSTATSGFAGAIGQK; AVANYDSVEEGEK; AYALAFAER; VVLVTGAGAGLGR; GALVVVNDLGGDFK; CEAVVADVLDK; FIYEGSSDFSCLPTFGVIIGQK; IDVVVNNAGILR; ISDEDWDIIHR; LGLLGLANSLAIEGR; LQSTFVFEEIGR; RVLQQFADNDVSR; VLQQFADNDVSR; VQETGDIVISNAYVDLAPTSGTSAK; GSLAADKVVEEIR; IIMTSSASGIYGNFGQANYSAAK; LKCEAVVADVLDK; PQSIQESTGSIIEVLSK; VAVAIPNRPPDAVLTDTTSLNQAALYR; ICDFENASKPQSIQESTGSIIEVLSK; PILHGLCTFGFSAR; TALDAFGR; SNIHCNTIAPNAGSR; IDSEGGVSANHTSR; PVYPGQTLQTEMWK; SMMGGGLAEIPGLSINFAK; KVNAVFEWHITK; VLHGEQYLELYKPLPR; VNAVFEWHITK; LSGDWNPLHIDPNFASLAGFDK; KSNIHCNTIAPNAGSR; LPPFSYAYTELEAIMYALGVGASIK; FAKPVYPGQTLQTEMWK 1 IPI00019912.1
86 S_Total95_131 IPI00294380.3 |SWISS-PROT:Q16822 |TREMBL:Q6IB91 |REFSEQ_NP:NP_004554 |ENSEMBL:ENSP00000216780 |H-INV:HIT000030426 Tax_Id=9606 Phosphoenolpyruvate carboxykinase, mitochondrial precursor 32 SYLTEQVNQDLPK; EVLAELEALER; GVPLVYEAFNWR; VLSGDLGQLPTGIR; DFWEQEVR; TVIVTPSQR; EGALDLSGLR; GQLGNWMSPADFQR; AIDTTQLFSLPK; EIISFGSGYGGNSLLGK; LGTPVLQALGDGDFVK; DEAGHFLWPGFGENAR; TLIGHVPDQR; IFHVNWFR; RDEAGHFLWPGFGENAR; YNNCWLAR; CLHSVGQPLTGQGEPVSQWPCNPEK; IGVQLTDSAYVVASMR; VECVGDDIAWMR; DEGWLAEHMLILGITSPAGK; EIISFGSGYGGNSLLGKK; VLDWICR; FPGCMKGR; PWKPGDKEPCAHPNSR; QCPIMDPAWEAPEGVPIDAIIFGGR; LCQPEGIHICDGTEAENTATLTLLEQQGLIR; IIMHDPFAMR; PFFGYNFGHYLEHWLSMEGR; ETPIGLVPK; VLSGDLGQLPTGIRDFVEHSAR; TVIVTPSQRDTVPLPPGGAR; PMF; Comb 1 IPI00294380.3
87 S_Total95_147 IPI00465343.2 |SWISS-PROT:P00326 |TREMBL:Q71V49 |REFSEQ_NP:NP_000660 Tax_Id=9606 Alcohol dehydrogenase gamma chain 32 IIAVDINK; ELGATECINPQDYK; VIPLFTPQCGK; IIAVDINKDK; NPESNYCLK; IDAASPLEK; EMTDGGVDFSFEVIGR; KPIQEVLK; IIAVDINKDKFAK; AKELGATECINPQDYK; LVADFMAK; NPESNYCLKNDLGNPR; ELGATECINPQDYKK; AKELGATECINPQDYKK; PIQEVLK; PIQEVLKEMTDGGVDFSFEVIGR; GTLQDGTR; SDEHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDK; ELGATECINPQDYKKPIQEVLK; KPFSIEEVEVAPPK; AAVLWELK; FSLDALITNILPFEK; INEGFDLLR; KFSLDALITNILPFEK; VCLIGCGFSTGYGSAVK; VCLIGCGFSTGYGSAVKVAK; VTPGSTCAVFGLGGVGLSVVMGCK; GAIFGGFK; MVAAGICR; FTCSGKPIHHFVGVSTFSQYTVVDENAVAK; PIHHFVGVSTFSQYTVVDENAVAK; Comb; PMF 1 IPI00465343.2
88 S_Total95_235 IPI00025252.1 |SWISS-PROT:P30101 |REFSEQ_NP:NP_005304 |ENSEMBL:ENSP00000300289 |H-INV:HIT000036696 Tax_Id=9606 Protein disulfide-isomerase A3 precursor 32 ELSDFISYLQR; FLQDYFDGNLK; GFPTIYFSPANK; SEPIPESNDGPVK; DPNIVIAK; KKAQEDL; LNFAVASR; QAGPASVPLR; YGVSGYPTLK; FVMQEEFSR; MDATANDVPSPYEVR; FLQDYFDGNLKR; TFSHELSDFGLESTAGEIPVVAIR; DASIVGFFDDSFSEAHSEFLK; DGEEAGAYDGPR; DLLIAYYDVDYEK; EATNPPVIQEEKPK; GFPTIYFSPANKK; IFRDGEEAGAYDGPR; LAPEYEAAATR; TADGIVSHLK; VVVAENFDEIVNNENK; QAGPASVPLRTEEEFKK; RLAPEYEAAATR; LSKDPNIVIAK; FAHTNVESLVNEYDDNGEGIILFR; EATNPPVIQEEK; FAHTNVESLVNEYDDNGEGIILFRPSHLTNK; FISDKDASIVGFFDDSFSEAHSEFLK; LKGIVPLAK; KTFSHELSDFGLESTAGEIPVVAIR; PMF; Comb 1 IPI00025252.1
89 S_Total95_258 IPI00295684.1 |TREMBL:Q8N175 |REFSEQ_NP:NP_000412 |ENSEMBL:ENSP00000269576 Tax_Id=9606 Keratin 10 32 LAADDFR; LASYLDK; LASYLDKVR; QSVEADINGLR; ALEESNYELEGK; LENEIQTYR; SQYEQLAEQNR; DAEAWFNEK; AETECQNTEYQQLLDIK; ELTTEIDNNIEQISSYK; GSLGGGFSSGGFSGGSFSR; GSSGGGCFGGSSGGYGGLGGFGGGSFR; IRLENEIQTYR; LKYENEVALR; NQILNLTTDNANILLQIDNAR; QSLEASLAETEGR; SKELTTEIDNNIEQISSYK; TIDDLKNQILNLTTDNANILLQIDNAR; VLDELTLTK; ADLEMQIESLTEELAYLK; NVQALEIELQSQLALK; VTMQNLNDR; YENEVALR; NVSTGDVNVEMNAAPGVDLTQLLNNMR; SQYEQLAEQNRK; YCVQLSQIQAQISALEEQLQQIR; QSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIR; SLLEGEGSSGGGGR; HYSSSRSGGGGGGGGCGGGGGVSSLR; SGGGGGGGGCGGGGGVSSLR; HGNSHQGEPR; Comb; PMF 1 IPI00295684.1
90 S_Total95_639 IPI00465436.3 |SWISS-PROT:P04040 |TREMBL:Q9UC85; Q8TAK2 |REFSEQ_NP:NP_001743 |ENSEMBL:ENSP00000241052 |H-INV:HIT000005408 Tax_Id=9606 Catalase 32 DLFNAIATGK; AFYVNVLNEEQR; ADVLTTGAGNPVGDK; DPILFPSFIHSQK; DYPLIPVGK; FSTVAGESGSADTVR; LCENIAGHLK; FNTANDDNVTQVR; LSQEDPDYGIR; DAQIFIQK; LVNANGEAVYCK; NLSVEDAAR; FYTEDGNWDLVGNNTPIFFIR; GAGAFGYFEVTHDITK; NAIHTFVQSGSHLAAR; LNVITVGPR; FSTVAGESGSADTVRDPR; LFAYPDTHR; LGPNYLHIPVNCPYR; NFTEVHPDYGSHIQALLDK; RFNTANDDNVTQVR; VWPHKDYPLIPVGK; ADVLTTGAGNPVGDKLNVITVGPR; DPASDQMQHWK; GPLLVQDVVFTDEMAHFDR; HMNGYGSHTFK; NPVNYFAEVEQIAFDPSNMPPGIEASPDK; VVHAKGAGAFGYFEVTHDITK; NFTEVHPDYGSHIQALLDKYNAEKPK; DPDMVWDFWSLRPESLHQVSFLFSDR; DGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVR; PMF; Comb 1 IPI00465436.3
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home