Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
871 S_Total95_4903 IPI00477431.1 |ENSEMBL:ENSP00000347890 Tax_Id=9606 98 kDa protein 11 QIELACDSQEDVDSWK; NLVDSYVAIINK; PGPQSVFANSDLFPAPPQIPSR; LQSQLLSIEK; TLNQQLTNHIR; VPVGDQPPDIEYQIK; ESSLILAVTPANMDLANSDALK; LQDAFSSIGQSCHLDLPQIAVVGGQSAGK; CVDLVIQELINTVR; CVDLVIQELINTVRQCTSK; EISYAIKNIHGHETGLFTPDLAFEAIVK 1 IPI00477431.1
872 S_Total95_4940 IPI00479223.1 |ENSEMBL:ENSP00000351701 Tax_Id=9606 72 kDa protein 11 GSPFPEVAESVQQELESYR; LTSAVSSLPELLEK; SLLDIISDPDAGTPEDK; VNLEESSGVENSPAGARPK; LEDIANAALAASAVTQVAK; VNLEESSGVENSPAGAR; ALTDAGCNLNPLQYIK; KALTDAGCNLNPLQYIK; MAAAAAATAAAAASIRER; MASAPASYGSTTTK; SIMGLEGEDEGAISMLSDNTAK 1 IPI00479223.1
873 S_Total95_5045 IPI00290546.2 |TREMBL:Q5JYU0; Q7KZ48 |REFSEQ_NP:NP_003997 |ENSEMBL:ENSP00000354923 Tax_Id=9606 Dystrophin 11 ILADLEEENR; LRQLLEQPQAEAK; SEVEMVIKTGRQIVQK; QEESLKNIKDSLQQSSGR; SLEGSDDAVLLQR; EKVNAIEREK; GLSPLPSPPEMMPTSPQSPR; AWTELTDWLSLLDQVIK; QAEGLSEDGAAMAVEPTQIQLSKR; VSEREAALEETHRLLQQFPLDLEK; ELQEATDELDLK 1 IPI00290546.2
874 S_Total95_5114 IPI00219314.5 |SWISS-PROT:O15027 |TREMBL:Q8N347; Q5SXP0 |REFSEQ_XP:XP_088459 |ENSEMBL:ENSP00000277536 |H-INV:HIT000000016 Tax_Id=9606 OTTHUMP00000022589 11 KGESWFFR; ADSGPTQPPLSLSPAPETK; LLPSAPQTLPDGPLASPAR; GLANPEPAPEPK; FSVPHVCARFGPGGQLIK; GSVSQPSTPSPPK; NEHRPASALVNPLAR; AGSALPGFANSPAGSTSVVLVPPAHGTLVPDGNK; PTGIFQTSANSSFEPVKSHLVGVKPFEADR; PQELVGTFIQQEVGKPEDEASGSFFK; SEPALAPADFVAPLAPLPIPSNLFVPTPDAEEPQLPDGTGR 1 IPI00219314.5
875 S_Total95_5190 IPI00374563.2 |SWISS-PROT:O00468 Tax_Id=9606 Agrin precursor 11 LELGIGPGAATR; SAGDVDTLAFDGR; VVISGFGDPLICDNQVSTGDTR; EAACLQQTQIEEAR; GKDFLALALLDGR; VLPEGGAQCECPLGR; SGAARGLLLQK; SPCQPNPCHGAAPCR; SIESTLDDLFR; KSPCPSVVAPVCGSDASTYSNECELQR; DLGEKMALEVVFLARGPSGLLLYNGQK 2 IPI00374563.2, IPI00479925.1
876 S_Total95_5261 IPI00001871.2 |SWISS-PROT:Q96IZ0 |REFSEQ_NP:NP_002574 |ENSEMBL:ENSP00000328088 |H-INV:HIT000032989 Tax_Id=9606 PRKC apoptosis WT1 regulator protein 11 LMQDKEEMIGKLK; STGVVNIPAAECLDEYEDDEAGQK; DANVSGTLVSSSTLEK; DEEEPDGVPEK; STTSVSEEDVSSR; DEEEPDGVPEKGK; DLDDIEDENEQLK; RSEDEPPAASASAAPPPQR; TSSGLGGSTTDFLEEWK; STGVVNIPAAECLDEYEDDEAGQKERK; EDAITQQNTIQNEAVNLLDPGSSYLLQEPPR 1 IPI00001871.2
877 S_Total95_5455 IPI00556319.1 |TREMBL:Q53FG3 |ENSEMBL:ENSP00000355011 Tax_Id=9606 Interleukin enhancer binding factor 2 variant 11 NQDLAPNSAEQASILSLVTK; VKPAPDETSFSEALLK; WFEENASQSTVK; ILPTLEAVAALGNK; VLQSALAAIR; ILITTVPPNLR; GTMTTGHNVADLVVILK; AQDPSEVLTMLTNETGFEISSSDATVK; FPGFEPLTPWILDLLGHYAVMNNPTR; PFVPHIPFDFYLCEMAFPR; INNVIDNLIVAPGTFEVQIEEVR 2 IPI00005198.2, IPI00556319.1
878 S_Total95_5805 IPI00455210.1 |SWISS-PROT:Q14839-2 |ENSEMBL:ENSP00000312419 |H-INV:HIT000021250 Tax_Id=9606 Splice Isoform 2 of Chromodomain helicase-DNA-binding protein 4 11 STAPETAIECTQAPAPASEDEK; LLLLQKMLKNLK; GPFLVSAPLSTIINWER; MLDLLEDFLEHEGYK; APEPTPQQVAQQQ; EEEMGEEEEVER; FHNLEGFLEEFADIAK; NQDETEDTELQGMNEYLSSFK; KEVMLQNGETPK; RHDYWLLAGIINHGYAR; SSAQLLEDWGMEDIDHVFSEEDYR 2 IPI00455210.1, IPI00000846.1
879 S_Total95_5857 IPI00420065.1 |TREMBL:Q658N9; Q6ZND2; Q709F0; Q9H9R3; Q658Y2 |REFSEQ_NP:NP_115545 |H-INV:HIT000005928; HIT000028633; HIT000027785 Tax_Id=9606 Putative acyl-CoA dehydrogenase 11 TFSTVLPQIDTTGQLFVQTR; VPATNLILGEGR; LDNIVFHPK; DEDSYVINGK; DLTIPGLSPAER; EVTEFYVQNENSVDK; EATLTIAQYR; VQKALFSIGFPVPK; WWSSGAGNPK; VEGLWNLFLPAVSGLSHVDYALIAEETGK; YLLGNNSSEDSFLFANIVQPLAETGLQLSK 2 IPI00420065.1, IPI00553026.1
880 S_Total95_8627 IPI00515021.1 |SWISS-PROT:P15502-4 |REFSEQ_NP:NP_000492 |ENSEMBL:ENSP00000313565 Tax_Id=9606 Splice Isoform 4 of Elastin precursor 11 SAAKVAAKAQLR; AAKYGVGTPAAAAAKAAAK; AGYPTGTGVGPQAAAAAAAK; LPYGYGPGGVAGAAGK; VPGVGLPGVYPGGVLPGAR; YGAAGLGGVLGGAGQFPLGGVAAR; YGVGTPAAAAAK; EGDPSSSQHLPSTPSSPR; FPGVGVLPGVPTGAGVK; PGFGLSPIFPGGACLGK; YGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAK 1 IPI00515021.1
881 S_Total95_5 IPI00030182.1 |SWISS-PROT:Q14353 |TREMBL:Q53Y34 |REFSEQ_NP:NP_000147 |ENSEMBL:ENSP00000252288 |H-INV:HIT000037675 Tax_Id=9606 Guanidinoacetate N-methyltransferase 10 LLKPGGVLTYCNLTSWGELMK; YYAFPQMITPLVTK; VQEAPIDEHWIIECNDGVFQR; PGGVLTYCNLTSWGELMK; VLEVGFGMAIAASK; WETPYMHALAAAASSK; YSDITIMFEETQVPALLEAGFR; TEVMALVPPADCR; LRDWAPR; Comb 1 IPI00030182.1
882 S_Total95_76 IPI00218108.1 |SWISS-PROT:Q9UN36-2 |TREMBL:Q68DW2; Q86U46 |REFSEQ_NP:NP_057334; NP_963835; NP_963832; NP_963294 |ENSEMBL:ENSP00000344620 |H-INV:HIT000000964 Tax_Id=9606 Splice Isoform 2 of NDRG2 protein 10 LDPTQTSFLK; NIITHAPNLDNIELYWNSYNNR; YALNHPDTVEGLVLINIDPNAK; TASLTSAASVDGNR; MADSGGQPQLTQPGK; LTGLTSSIPEMILGHLFSQEELSGNSELIQK; CPVMLVVGDQAPHEDAVVECNSK; RPAILTYHDVGLNYK; SCFQPLFQFEDMQEIIQNFVR; Comb; PMF 3 IPI00218108.1, IPI00382995.1, IPI00479319.1
883 S_Total95_115 IPI00247601.4 |REFSEQ_XP:XP_294070 Tax_Id=9606 PREDICTED: similar to Glyceraldehyde 3-phosphate dehydrogenase, liver (GAPDH) 10 LVINGNPITIFQER; LVINGNPITIFQERDPSK; DRMGWAPAGGR; IISNASCTTNCLAPRAK; RCAQAGAEERVAPLTFAK; GLMTTVHAITATQK; CAQAGAEERVAPLTFAKDR; VLHDNFGIVKGLMTTVHAITATQK; VIISAPSADASVFIMGVNNEKYDNSLK; Comb 1 IPI00247601.4
884 S_Total95_187 IPI00106913.2 |SWISS-PROT:Q9BTZ2-1 |TREMBL:Q71UQ6; Q58IU4 |REFSEQ_NP:NP_066284 |ENSEMBL:ENSP00000326219 |H-INV:HIT000031364; HIT000004344 Tax_Id=9606 Hep27-like protein 10 LAQDGAHVVVSSR; VALVTASTDGIGFAIAR; RLAQDGAHVVVSSR; DPLANKVALVTASTDGIGFAIAR; RGGGSVVIVSSIAAFSPSPGFSPYNVSK; TLAIELAPR; VNCLAPGLIK; TALLGLTK; TALLGLTKTLAIELAPR; Comb; PMF 1 IPI00106913.2
885 S_Total95_195 IPI00219910.1 |SWISS-PROT:P30043 |REFSEQ_NP:NP_000704 |ENSEMBL:ENSP00000263368 Tax_Id=9606 Flavin reductase 10 NDLSPTTVMSEGAR; TVAGQDAVIVLLGTR; PAHVVVGDVLQAADVDK; CLTTDEYDGHSTYPSHQYQ; LPSEGPRPAHVVVGDVLQAADVDK; VVACTSAFLLWDPTK; LQAVTDDHIR; VVACTSAFLLWDPTKVPPR; YVAVMPPHIGDQPLTGAYTVTLDGR; PMF; Comb 1 IPI00219910.1
886 S_Total95_200-1 IPI00419424.3 |TREMBL:Q6PIH6 |H-INV:HIT000042066 Tax_Id=9606 IGKV1-5 protein 10 SGTASVVCLLNNFYPR; TVAAPSVFIFPPSDEQLK; RTVAAPSVFIFPPSDEQLK; DSTYSLSSTLTLSK; VDNALQSGNSQESVTEQDSK; VYACEVTHQGLSSPVTK; HKVYACEVTHQGLSSPVTK; VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK; FSGSGSGTDFTLK; Comb 1 IPI00419424.3
887 S_Total95_200-2 IPI00550731.2 |TREMBL:Q8TCD0 |H-INV:HIT000039497 Tax_Id=9606 Hypothetical protein 10 SGTASVVCLLNNFYPR; TVAAPSVFIFPPSDEQLK; RTVAAPSVFIFPPSDEQLK; DSTYSLSSTLTLSK; VDNALQSGNSQESVTEQDSK; VYACEVTHQGLSSPVTK; HKVYACEVTHQGLSSPVTK; VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK; FSGSGSGTDFTLK; Comb 1 IPI00550731.2
888 S_Total95_202 IPI00441043.1 |TREMBL:Q6P5S8 Tax_Id=9606 Hypothetical protein 10 SGTASVVCLLNNFYPR; TVAAPSVFIFPPSDEQLK; RTVAAPSVFIFPPSDEQLK; DSTYSLSSTLTLSK; VDNALQSGNSQESVTEQDSK; VYACEVTHQGLSSPVTK; HKVYACEVTHQGLSSPVTK; VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK; FSGSGSGTDFTLTITR; Comb 1 IPI00441043.1
889 S_Total95_220 IPI00328348.4 |ENSEMBL:ENSP00000341176 Tax_Id=9606 16 kDa protein 10 TITLEVEPSDTIENVK; ESTLHLVLR; LIFAGKQLEDGR; TLSDYNIQK; IQDKEGIPPDKQR; EGIPPDQQR; LFLQRGGRADANMQIFVK; TLSDYNIQKESTLHLVLR; IQDKEGIPPDQQR; Comb; PMF 1 IPI00328348.4
890 S_Total95_241 IPI00604590.1 |REFSEQ_NP:NP_001018146 Tax_Id=9606 Nucleoside-diphosphate kiNase 2 isoform 1 10 TFIAIKPDGVQR; DRPFFAGLVK; GDFCIQVGR; DRPFFPGLVK; VMLGETNPADSKPGTIR; EISLWFKPEELVDYK; YMNSGPVVAMVWEGLNVVK; GLVGEIIKR; GLVGEIIK; PMF; Comb 1 IPI00604590.1
891 S_Total95_268 IPI00020986.2 |SWISS-PROT:P51884 |TREMBL:Q53FV4 |REFSEQ_NP:NP_002336 |ENSEMBL:ENSP00000266718 |H-INV:HIT000033002 Tax_Id=9606 Lumican precursor 10 ISNIPDEYFK; LKEDAVSAAFK; SLEDLQLTHNK; LPSGLPVSLLTLYLDNNK; NIPTVNENLENYYLEVNQLEK; FNALQYLR; SLEYLDLSFNQIAR; RFNALQYLR; ISETSLPPDMYECLR; Comb; PMF 1 IPI00020986.2
892 S_Total95_318 IPI00295625.1 |SWISS-PROT:P53597 |TREMBL:Q6IAL5 |REFSEQ_NP:NP_003840 |ENSEMBL:ENSP00000295783 |H-INV:HIT000029686; HIT000008041 Tax_Id=9606 Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursor 10 GGQTHLGLPVFNTVK; LIGPNCPGVINPGECK; MGHAGAIIAGGK; QGTFHSQQALEYGTK; IICQGFTGK; ISALQSAGVVVSMSPAQLGTTIYK; LVGGTTPGK; PVVSFIAGLTAPPGR; ISALQSAGVVVSMSPAQLGTTIYKEFEK; Comb 1 IPI00295625.1
893 S_Total95_348 IPI00220642.4 |SWISS-PROT:P61981 |TREMBL:Q6FH52 |REFSEQ_NP:NP_036611 |ENSEMBL:ENSP00000306330 |H-INV:HIT000007504; HIT000039050 Tax_Id=9606 14-3-3 protein gamma 10 DSTLIMQLLR; VISSIEQK; NLLSVAYK; YDDMAAAMK; YLAEVATGEK; NVTELNEPLSNEER; ELEAVCQDVLSLLDNYLIK; TAFDDAIAELDTLNEDSYK; DNLTLWTSDQQDDDGGEGNN; Comb; PMF 1 IPI00220642.4
894 S_Total95_373 IPI00219673.5 |SWISS-PROT:Q9Y2Q3 |TREMBL:Q6FII1 |REFSEQ_NP:NP_057001 |ENSEMBL:ENSP00000351181 |H-INV:HIT000003115 Tax_Id=9606 Glutathione S-transferase kappa 1 10 NEDITEPQSILAAAEK; HHLQIPIHFPK; AGMSAEQAQGLLEK; DSGNKPPGLLPR; FLTAVNLEHPEMLEK; YQNIWNINLQLR; WMGPIPPAVNAR; DFLSVMLEK; MELLAHLLGEK; Comb 1 IPI00219673.5
895 S_Total95_391-1 IPI00554617.1 |SWISS-PROT:O14773-2 Tax_Id=9606 Splice Isoform 2 of Tripeptidyl-peptidase I precursor 10 LFGGNFAHQASVAR; PSYQEEAVTK; LYQQHGAGLFDVTR; AYPDVAALSDGYWVVSNR; ILSGRPPLGFLNPR; GLTLLFASGDSGAGCWSVSGR; PPLGFLNPR; VPIPWVSGTSASTPVFGGILSLINEHR; GCHESCLDEEVEGQGFCSGPGWDPVTGWGTPNFPALLK; PMF; Comb 1 IPI00554617.1
896 S_Total95_391-2 IPI00298237.4 |SWISS-PROT:O14773-1 |TREMBL:Q53HT1; Q53HP2 |REFSEQ_NP:NP_000382 |ENSEMBL:ENSP00000299427 |H-INV:HIT000036875 Tax_Id=9606 Splice Isoform 1 of Tripeptidyl-peptidase I precursor 10 LFGGNFAHQASVAR; PSYQEEAVTK; LYQQHGAGLFDVTR; AYPDVAALSDGYWVVSNR; ILSGRPPLGFLNPR; GLTLLFASGDSGAGCWSVSGR; PPLGFLNPR; VPIPWVSGTSASTPVFGGILSLINEHR; GCHESCLDEEVEGQGFCSGPGWDPVTGWGTPNFPALLK; PMF; Comb 1 IPI00298237.4
897 S_Total95_392 IPI00305360.1 |SWISS-PROT:Q9BSE5 |TREMBL:Q5TDH1 |REFSEQ_NP:NP_079034 |ENSEMBL:ENSP00000235417 |H-INV:HIT000010311; HIT000032209 Tax_Id=9606 Agmatinase, mitochondrial precursor 10 HGPVGLLHVDAHTDTTDK; KHGPVGLLHVDAHTDTTDK; LPVQTSPEGLDAAFIGVPLDTGTSNRPGAR; VVQIGIR; CVDEGLLDCK; CVDEGLLDCKR; GSSTTLDPYR; LPVQTSPEGLDAAFIGVPLDTGTSNR; LYHGAPFR; PMF; Comb 1 IPI00305360.1
898 S_Total95_396 IPI00007611.1 |SWISS-PROT:P48047 |TREMBL:Q6IBI2; Q5U042; Q53HH2 |REFSEQ_NP:NP_001688 |ENSEMBL:ENSP00000290299 |H-INV:HIT000039663; HIT000039160 Tax_Id=9606 ATP synthase oligomycin sensitivity conferral protein, mitochondrial precursor 10 SFLSQGQVLK; VAASVLNPYVK; FSPLTTNLINLLAENGR; GEVPCTVTSASPLEEATLSELK; LVRPPVQVYGIEGR; LSNTQGVVSAFSTMMSVHR; YATALYSAASK; MAAPAVSGLSR; TDPSILGGMIVR; Comb; PMF 1 IPI00007611.1
899 S_Total95_397 IPI00029997.1 |SWISS-PROT:O95336 |REFSEQ_NP:NP_036220 |ENSEMBL:ENSP00000252603 |H-INV:HIT000036464 Tax_Id=9606 6-phosphogluconolactonase 10 TVIFVATGEGK; LCWFLDEAAAR; ELPAAVAPAGPASLAR; IVAPISDSPKPPPQR; LVPFDHAESTYGLYR; VTLTLPVLNAAR; ILEDQEENPLPAALVQPHTGK; LPIPESQVITINPELPVEEAAEDYAK; AACCLAGARARFALGLSGGSLVSMLAR; PMF; Comb 1 IPI00029997.1
900 S_Total95_401 IPI00024175.3 |SWISS-PROT:O14818-1 |REFSEQ_NP:NP_002783 |ENSEMBL:ENSP00000217153 |H-INV:HIT000031933; HIT000001754 Tax_Id=9606 Splice Isoform 1 of Proteasome subunit alpha type 7 10 ALLEVVQSGGK; LYQTDPSGTYHAWK; LTVEDPVTVEYITR; NYTDEAIETDDLTIK; DIVVLGVEK; GRDIVVLGVEK; GSTAVGVRGRDIVVLGVEK; AITVFSPDGHLFQVEYAQEAVK; ICALDDNVCMAFAGLTADAR; Comb; PMF 1 IPI00024175.3
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30]下一页最后一页Home