Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
121 S_Total95_3176 IPI00411553.2 |TREMBL:Q9UG88; Q7Z3I6; Q6IQ33 |ENSEMBL:ENSP00000194871 |H-INV:HIT000004287; HIT000004531; HIT000023846 Tax_Id=9606 COBLL1 protein 29 DYQSQEPLDLTK; PVTIPASQVSTQNLK; DTGTAPFAPNLEEINNILESK; GFFSFFQR; TDDDVIGQAPAEASPPPIAPK; TESPSASALVQPPANTEEGK; VSPHASLQELAPIICSK; DQTASAPATPLVNK; PNTPIGMLEVEKVILKPK; SQDIPFVSTDIINTLK; VEAENISPK; DAAIQTTPSCNSFDGK; SNTISKPYISNTLPSDAPK; DPICAHGNDDLLPPVDR; ETAIQTEDSAISESPEEPLPNLK; FVDIPQLGVSDK; KTEINVEGVAK; NDPDSALGNGSGEFSQNSMEEK; PSSFFLQMQK; PYISNTLPSDAPK; SLGPNQENVVQNEIIVYPENTEDNMK; YTDVSSAADSVESTAFIMEQK; DMLPSPEQTLSPLSK; EYIPKIGMTTYKIVPPK; SQGTLIIHSEDPLTVK; PVTIPASQVSTQNLKTLETFGAPR; ENNSAHNEQNSQIPTPTDGPSFTVMR; NNNIDMEVERPSNSEAHETDTAISYK; TEHQVPSSVSSPDDAMVSPLKPAPK 1 IPI00411553.2
122 S_Total95_98-1 IPI00514377.3 |TREMBL:Q5SP17; Q5SP14 |REFSEQ_NP:NP_005336 |H-INV:HIT000020872 Tax_Id=9606 Heat shock 70kDa protein 1A 28 VEIIANDQGNR; VEILANDQGNR; TTPSYVAFTDTER; FEELCSDLFR; IINEPTAAAIAYGLDR; ATAGDTHLGGEDFDNR; DAGVIAGLNVLR; AFYPEEISSMVLTK; AKIHDIVLVGGSTR; NQVALNPQNTVFDAK; LVNHFVEEFK; ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK; LLQDFFNGR; SINPDEAVAYGAAVQAAILMGDK; GGSGSGPTIEEVD; TLSSSTQASLEIDSLFEGIDFYTSITR; FGDPVVQSDMK; CQEVISWLDANTLAEK; HWPFQVINDGDKPK; AAAIGIDLGTTYSCVGVFQHGK; EIAEAYLGYPVTNAVITVPAYFNDSQR; NALESYAFNMK; GVPQIEVTFDIDANGILNVTATDK; RKELEQVCNPIISGLYQGAGGPGPGGFGAQGPK; SENVQDLLLLDVAPLSLGLETAGGVMTALIK; Comb; QTQIFTTYSDNQPGVLIQVYEGER; AQIHDLVLVGGSTR; PMF 1 IPI00514377.3
123 S_Total95_98-2 IPI00304925.2 |SWISS-PROT:P08107 |TREMBL:Q59EJ3; Q9UQC1; Q5JQI4 |REFSEQ_NP:NP_005337 |H-INV:HIT000034281; HIT000030904; HIT000038434 Tax_Id=9606 Heat sHock 70kDa protein 1B 28 VEIIANDQGNR; VEILANDQGNR; TTPSYVAFTDTER; FEELCSDLFR; IINEPTAAAIAYGLDR; ATAGDTHLGGEDFDNR; DAGVIAGLNVLR; AFYPEEISSMVLTK; AKIHDIVLVGGSTR; NQVALNPQNTVFDAK; LVNHFVEEFK; ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK; LLQDFFNGR; SINPDEAVAYGAAVQAAILMGDK; GGSGSGPTIEEVD; TLSSSTQASLEIDSLFEGIDFYTSITR; FGDPVVQSDMK; CQEVISWLDANTLAEK; HWPFQVINDGDKPK; AAAIGIDLGTTYSCVGVFQHGK; EIAEAYLGYPVTNAVITVPAYFNDSQR; NALESYAFNMK; GVPQIEVTFDIDANGILNVTATDK; RKELEQVCNPIISGLYQGAGGPGPGGFGAQGPK; SENVQDLLLLDVAPLSLGLETAGGVMTALIK; Comb; QTQIFTTYSDNQPGVLIQVYEGER; AQIHDLVLVGGSTR; PMF 1 IPI00304925.2
124 S_Total95_105 IPI00001539.8 |SWISS-PROT:P42765 |REFSEQ_NP:NP_006102 |ENSEMBL:ENSP00000285093 |H-INV:HIT000030746; HIT000011287 Tax_Id=9606 3-ketoacyl-CoA thiolase, mitochondrial 28 DFTATDLSEFAAK; SLDLDISK; TPFGAYGGLLK; ITAHLVHELR; PQTTLEQLQK; RTPFGAYGGLLK; ETPALTINR; AANDAGYFNDEMAPIEVK; DGTVTAGNASGVADGAGAVIIASEDAVK; DMDLVEVNEAFAPQYLAVER; IVGYFVSGCDPSIMGIGPVPAISGALK; TNVNGGAIALGHPLGGSGSR; VSPETVDSVIMGNVLQSSSDAIYLAR; LCGSGFQSIVNGCQEICVK; DGTVTAGNASGVADGAGAVIIASEDAVKK; YAVGSACIGGGQGIAVIIQSTA; EAEVVLCGGTESMSQAPYCVR; EECDKYALQSQQR; QTMQVDEHAR; YALQSQQR; KDGTVTAGNASGVADGAGAVIIASEDAVK; QTMQVDEHARPQTTLEQLQK; ISREECDKYALQSQQR; IVGYFVSGCDPSIMGIGPVPAISGALKK; KDGTVTAGNASGVADGAGAVIIASEDAVKK; HNFTPLAR; SLDLDISKTNVNGGAIALGHPLGGSGSR; PMF; Comb 1 IPI00001539.8
125 S_Total95_226 IPI00024990.6 |SWISS-PROT:Q02252 |TREMBL:O43573; Q53FN8; Q53H94 |REFSEQ_NP:NP_005580 |ENSEMBL:ENSP00000342564 |H-INV:HIT000032076; HIT000041514 Tax_Id=9606 Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial precursor 28 AFPAWADTSVLSR; VCNLIDSGTK; WLPELVEHAK; AGEYIFER; TLADAEGDVFR; EGASILLDGRK; EGASILLDGR; AISFVGSNK; ENTLNQLVGAAFGAAGQR; VNAGDQPGADLGPLITPQAK; EEDATLSSPAVVMPTMGR; QGIQFYTQLK; SDKWIDIHNPATNEVIGR; VPGATMLLAK; WIDIHNPATNEVIGR; CMALSTAVLVGEAK; GLQVVEHACSVTSLMMGETMPSITK; SSFRGDTNFYGK; DMDLYSYR; AEMDAAIASCK; AISFVGSNKAGEYIFERGSR; KWLPELVEHAK; NHGVVMPDANK; YAHLVDVGQVGVNVPIPVPLPMFSFTGSR; LLQDSGAPDGTLNIIHGQHEAVNFICDHPDIK; NHGVVMPDANKENTLNQLVGAAFGAAGQR; GYENGNFVGPTIISNVKPNMTCYK; PMF; Comb 1 IPI00024990.6
126 S_Total95_618 IPI00019359.2 |SWISS-PROT:P35527 |REFSEQ_NP:NP_000217 |ENSEMBL:ENSP00000246662 Tax_Id=9606 Keratin 9 28 LASYLDK; TLLDIDNTR; FSSSSGYGGGSSR; SGGGGGGGLGSGGSIR; DIENQYETQITQIEHEVSSSGQEVQSSAK; DQIVDLTVGNNK; EIETYHNLLEGGQEDFESSGAGK; GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR; HGVQELEIELQSQLSK; NYSPYYNTIDDLKDQIVDLTVGNNK; QGVDADINGLR; SDLEMQYETLQEELMALK; VQALEEANNDLENK; NYSPYYNTIDDLK; TLNDMRQEYEQLIAK; GGSGGSYGGGGSGGGYGGGSGSR; LASYLDKVQALEEANNDLENK; QEIECQNQEYSLLLSIK; QVLDNLTMEK; GSRGGSGGSYGGGGSGGGYGGGSGSR; GGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSR; GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK; NYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTR; HGVQELEIELQSQLSKK; KDIENQYETQITQIEHEVSSSGQEVQSSAK; LASYLDKVQALEEANNDLENKIQDWYDK; LEKEIETYHNLLEGGQEDFESSGAGK; Comb; PMF 1 IPI00019359.2
127 S_Total95_794 IPI00299145.8 |SWISS-PROT:P48668 |REFSEQ_NP:NP_775109 |ENSEMBL:ENSP00000252250 Tax_Id=9606 Keratin, type II cytoskeletal 6E 28 EYQELMNVK; NKYEDEINKR; TLNNKFASFIDKVR; FASFIDK; TLNNKFASFIDK; FASFIDKVR; LLEGEECR; LALDVEIATYR; NLDLDSIIAEVK; AQYEEIAQR; NLDLDSIIAEVKAQYEEIAQR; YEELQVTAGR; AEAESWYQTK; QNLEPLFEQYINNLR; WTLLQEQGTK; ADTLTDEINFLR; SGFSSISVSR; TAAENEFVTLK; ISIGGGSCAISGGYGSR; GSGGLGGACGGAGFGSR; LEGLEDALQK; NKLEGLEDALQK; AIGGGLSSVGGGSSTIK; LLKEYQELMNVK; TAAENEFVTLKK; NMQDLVEDLK; KQCASLQAAIADAEQRGEMALK; PMF; Comb 1 IPI00299145.8
128 S_Total95_796 IPI00293665.6 |SWISS-PROT:P04259 |REFSEQ_NP:NP_005546 |ENSEMBL:ENSP00000252252 Tax_Id=9606 Keratin, type II cytoskeletal 6B 28 EYQELMNVK; NKYEDEINKR; TLNNKFASFIDKVR; FASFIDK; TLNNKFASFIDK; FASFIDKVR; LLEGEECR; LALDVEIATYR; NLDLDSIIAEVK; AQYEEIAQR; NLDLDSIIAEVKAQYEEIAQR; YEELQVTAGR; AEAESWYQTK; QNLEPLFEQYINNLR; WTLLQEQGTK; ADTLTDEINFLR; SGFSSISVSR; TAAENEFVTLK; ISIGGGSCAISGGYGSR; GSGGLGGACGGAGFGSR; LEGLEDALQK; NKLEGLEDALQK; QCANLQAAIADAEQR; LLKEYQELMNVK; TAAENEFVTLKK; NMQDLVEDLK; ATGGGLSSVGGGSSTIK; PMF; Comb 1 IPI00293665.6
129 S_Total95_830 IPI00334779.2 |SWISS-PROT:P30613-2 |TREMBL:Q16715; O75758; Q16716 |REFSEQ_NP:NP_870986 |ENSEMBL:ENSP00000271946 Tax_Id=9606 Splice Isoform L-type of Pyruvate kinase, isozymes R/L 28 GDLGIEIPAEK; GDLGIEIPAEKVFLAQK; PVAIALDTK; STSIIATIGPASR; DPTEVTAIGAVEAAFK; IGPEGLVTQVENGGVLGSR; FGVEHGVDIVFASFVR; GSQVLVTVDPAFR; IYIDDGLISLVVQK; KGVNLPGAQVDLPGLSEQDVR; LNFSHGSHEYHAESIANVR; TGILQGGPESEVELVK; AETSDVANAVLDGADCIMLSGETAK; EPPEAIWADDVDR; GNANTVWVDYPNIVR; GVNLPGAQVDLPGLSEQDVR; RVQFGIESGK; EAVESFAGSPLSYRPVAIALDTK; EPPEAIWADDVDRR; EAVESFAGSPLSYR; FDEILEVSDGIMVAR; GNFPVEAVK; PVVCATQMLESMITK; STSIIATIGPASRSVERLK; VGDLVIVVTGWR; AAPLSRDPTEVTAIGAVEAAFK; PVVCATQMLESMITKPR; PMF; Comb 1 IPI00334779.2
130 S_Total95_1065 IPI00328753.1 |SWISS-PROT:Q86UP2-1 |TREMBL:Q5GGW3 |REFSEQ_NP:NP_891556 |ENSEMBL:ENSP00000348562 Tax_Id=9606 Splice Isoform 1 of Kinectin 28 ALKEEIGNVQLEK; GELTTLIHQLQEK; SVEELLEAELLK; VQELQNLLK; LQALANEQAAAAHELEK; TQLLQDVQDENK; TVEELLETGLIQVATK; AAGDTTVIENSDVSPETESSEK; DAVSNTTNQLESK; QQQVEAVELEAK; TETDKENAEVK; EISGLWNELDSLK; TQLLQDVQDENKLFK; AQQSLELIQSK; EASSASQFEELEIVLK; EESLQMQVQDILEQNEALK; LQTLVSEQPNK; LSDALAVEDDQVAPVPLNVVETSSSVR; QNDQVSFASLVEELK; SVLAETEGILQK; VSVPSNLSYGEWLHGFEK; EVIDLLKPDQVEGIQK; QNDQVSFASLVEELKK; AQIQQFHSQIAAQTSASVLAEELHK; ETMSVSLNQTVTQLQQLLQAVNQQLTK; TENVFVDEPLIHATTYIPLMDNADSSPVVDK; ERQQQVEAVELEAK; PMF; Comb 1 IPI00328753.1
131 S_Total95_1109 IPI00140420.4 |SWISS-PROT:Q7KZF4 |TREMBL:Q86UF7; Q96AG0; Q59FF0 |REFSEQ_NP:NP_055205 |ENSEMBL:ENSP00000346762 |H-INV:HIT000021438; HIT000037857 Tax_Id=9606 Staphylococcal nuclease domain containing protein 1 28 LGTLSPAFSTR; NLPGLVQEGEPFSEEATLFTK; EADGSETPEPFAAEAK; SSHYDELLAAEAR; VLPAQATEYAFAFIQVPQDDDAR; DTNGENIAESLVAEGLATR; DTPDEPWAFPAR; NDIASHPPVEGSYAPR; TCATVTIGGINIAEALVSK; ADDADEFGYSR; DYVAPTANLDQK; SEAVVEYVFSGSR; VITEYLNAQESAK; VMQVLNADAIVVK; SLLSAEEAAK; GDVGLGLVK; PASPATETVPAFSER; ETCLITFLLAGIECPR; KEVPIHRVADISGDTQK; VNVTVDYIR; EVEVEVESMDK; SASYKPVFVTEITDDLHFYVQDVETGTQLEK; DIQNTQCLLNVEHLSAGCPHVTLQFADSK; VLPAQATEYAFAFIQVPQDDDARTDAVDSVVR; VNVTVDYIRPASPATETVPAFSER; PVFVTEITDDLHFYVQDVETGTQLEK; VWAHYEEQPVEEVMPVLEEK; Comb; PMF 1 IPI00140420.4
132 S_Total95_1139 IPI00329536.1 |SWISS-PROT:Q15075 |REFSEQ_NP:NP_003557 |ENSEMBL:ENSP00000317955 Tax_Id=9606 Early endosome antigen 1 28 IQNLEALLQK; QEVQDLQASLKEEK; IQAGEGETAVLNQLQEK; LQQQLTQAAQELAAEK; NHTLQEQVTQLTEK; QDFETLSQETK; LQSQYASSEATISQLR; EQALQDLQQQR; DLDCQQLQSR; EALMTELSTVK; EEQQLQGNINELK; ELVQVQTLMDNMTLER; HQLQVQMENTLK; ISVLQNNYEK; ITTQLDQVTAK; LAEIEEIK; LELNSMQEQLIQAQNTLK; LKEELSEVETK; LSLAQEDLISNR; QQHQEQQALQQSTTAK; IQTTVTELQK; KLDNTTAAVQELGR; PGIEDVAVLK; VLSLETSVNELNSQLNESK; ADLQNHLDTAQNALQDK; HYEAVHDAGNDSGHGGESNLALK; QAQENLHDQVQEQKAHLRAAQDR; Comb; PMF 1 IPI00329536.1
133 S_Total95_2201 IPI00010471.1 |SWISS-PROT:P13796 |TREMBL:Q53FI1; Q5TBN3; Q59GX5; Q9NTI9; Q5TBN4; Q5TBN5 |REFSEQ_NP:NP_002289 |ENSEMBL:ENSP00000315757 |H-INV:HIT000033370; HIT000022029; HIT000018435; HIT000034874; HIT000014758; HIT000022130 Tax_Id=9606 L-plastin 28 VYALPEDLVEVNPK; AYYHLLEQVAPK; FSLVGIGGQDLNEGNR; ISTSLPVLDLIDAIQPGSINYDLLK; KIENCNYAVELGK; VNDDIIVNWVNETLR; LNLAFIANLFNR; VDTDGNGYISFNELNDLFK; AACLPLPGYR; IENCNYAVELGK; NEALIALLR; QFVTATDVVR; YAFVNWINK; IGNFSTDIK; IGNFSTDIKDSK; ISFDEFIK; LSPEELLLR; EITENLMATGDLDQDGR; YTLNILEEIGGGQK; GDEEGVPAVVIDMSGLR; MINLSVPDTIDER; AECMLQQAER; IGLFADIELSR; VNHLYSDLSDALVIFQLYEK; YPALHKPENQDIDWGALEGETR; EGICAIGGTSEQSSVGTQHSYSEEEK; HVIPMNPNTNDLFNAVGDGIVLCK; PMF 1 IPI00010471.1
134 S_Total95_3577 IPI00100160.3 |SWISS-PROT:Q86VP6-1 |REFSEQ_NP:NP_060918 |ENSEMBL:ENSP00000299218 |H-INV:HIT000020865; HIT000025406; HIT000010676; HIT000002054; HIT000000546 Tax_Id=9606 Splice Isoform 1 of Cullin-associated NEDD8-dissociated protein 1 28 LTLIDPETLLPR; ALTLIAGSPLK; AVAALLTIPEAEK; DLLDTVLPHLYNETK; ISGSILNELIGLVR; LDIFEFLNHVEDGLK; TVIGELPPASSGSALAANVCK; ADVFHAYLSLLK; FCNVDDDELR; GYLISGSSYAR; LGTLSALDILIK; SVILEAFSSPSEEVK; TYIQCIAAISR; VALVTFNSAAHNKPSLIR; EGPAVVGQFIQDVK; FTISDHPQPIDPLLK; LSTLCPSAVLQR; TLEDPDLNVR; AAFECMYTLLDSCLDR; FMATNDLMTELQK; QEDVSVQLEALDIMADMLSR; IDLRPVLGEGVPILASFLR; QGGLLVNFHPSILTCLLPQLTSPR; RTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTR; RQYLLLHSLK; SPLMSEFQSQISSNPELAAIFESIQK; ITSEALLVTQQLVK; VIRPLDQPSSFDATPYIK 1 IPI00100160.3
135 S_Total95_3859 IPI00176193.5 |SWISS-PROT:Q05707-1 |REFSEQ_NP:NP_066933 Tax_Id=9606 Splice Isoform 1 of Collagen alpha 1(XIV) chain precursor 28 HVFFVDDFDAFK; ILPDTPQEPFALWEILNK; NSDPLVGVILDNGGK; IFASQASGFSDALTGMVK; IGLAQYSGDPR; TKETLLDAIK; TLFLGVTNLQAK; VVIESLQDR; TNQLNLQNTATK; VTVTPIYTDGEGVSVSAPGK; ITWDPPSSPVK; VIVVITDGR; DTLFTAESGTR; IISFLYSTVGALNK; HFLENLVTAFDVGSEK; IGILITDGK; GGNTLTGLALNYIFENSFK; IGILITDGKSQDDIIPPSR; LHIVVSETLVKVVIDCK; LQEIEGPSVSIMEK; GTETTLALPMASDLLLYDVTENSMR; IVYNNADGTEINEVEVDPITTFPLK; NLVVGDETTSSLR; YLHPEGLPSDYTISFLFR; YTAILNQIPSHSSSIR; ASAHAITGPPTELITSEVTAR; VEEQDREIKASAHAITGPPTELITSEVTAR; KIEDELITFVCETASATCPVVHK 2 IPI00176193.5, IPI00550918.1
136 S_Total95_4189 IPI00020557.1 |SWISS-PROT:Q07954 |TREMBL:Q59FG2; Q6LAF4; Q6LBN5 |REFSEQ_NP:NP_002323 |ENSEMBL:ENSP00000243077 Tax_Id=9606 Low-density lipoprotein receptor-related protein 1 precursor 28 AALSGANVLTLIEK; AVTDEEPFLIFANR; CDGEDDCGDNSDENPEECAR; CPLNYFACPSGR; DCPDGSDEAPEICPQSK; GVLFQPCER; ILQDDLTCR; VFFTDYGQIPK; GVGGAPPTVTLLR; LSGCSQDCEDLK; LYFSDATLDK; TTLLAGDIEHPR; CSCYEGWVLEPDGESCR; TCADVDECSTTFPCSQR; MYDAQQQQVGTNK; GYLFWTEWGQYPR; EDYIEFASLDGSNR; GPVGLAIDFPESK; TVLWPNGLSLDIPAGR; KLNLDGSNYTLLK; CDADADCMDGSDEEACGTGVR; WKCDGEDDCGDGSDEPK; NEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTR; CDNDNDCGDNSDEAGCSHSCSSTQFK; CDTEDDCGDHSDEPPDCPEFK; KPEHELFLVYGK; IVFPHGITLDLVSR; MLTPPLLLLLPLLSALVAAAIDAPKTCSPK 1 IPI00020557.1
137 S_Total95_35 IPI00011654.2 |SWISS-PROT:P07437 |TREMBL:Q5SU16; Q6P602; Q9BUU9; Q5JP53; Q5ST81; Q96B85; Q6LC01 |REFSEQ_NP:NP_821133 |ENSEMBL:ENSP00000259925 |H-INV:HIT000023602; HIT000039037; HIT000030765; HIT000033326; HIT000038721; HIT000032469; HIT000039303; HIT000030815; HIT000036235 Tax_Id=9606 Tubulin beta-2 chain 27 EVDEQMLNVQNK; NSSYFVEWIPNNVK; GHYTEGAELVDSVLDVVR; LAVNMVPFPR; SGPFGQIFRPDNFVFGQSGAGNNWAK; AILVDLEPGTMDSVR; EIVHIQAGQCGNQIGAK; PDNFVFGQSGAGNNWAK; ISEQFTAMFR; TAVCDIPPR; FPGQLNADLR; NMMAACDPR; KLAVNMVPFPR; LTTPTYGDLNHLVSATMSGVTTCLR; MREIVHIQAGQCGNQIGAK; EIVHLQAGQCGNQIGAK; LHFFMPGFAPLTSR; EAESCDCLQGFQLTHSLGGGTGSGMGTLLISK; ALTVPELTQQVFDAK; YLTVAAVFR; IMNTFSVVPSPK; MAVTFIGNSTAIQELFK; MAVTFIGNSTAIQELFKR; ISVYYNEATGGK; FWEVISDEHGIDPTGTYHGDSDLQLDR; IREEYPDR; Comb; PMF 1 IPI00011654.2
138 S_Total95_36 IPI00007752.1 |SWISS-PROT:P68371 |TREMBL:Q96HX0 |REFSEQ_NP:NP_006079 |ENSEMBL:ENSP00000341289 |H-INV:HIT000009868; HIT000027409; HIT000031181; HIT000033515; HIT000030740; HIT000038659; HIT000031264; HIT000038690; HIT000035986; HIT000031767; HIT000009441 Tax_Id=9606 Tubulin beta-? chain 27 EVDEQMLNVQNK; NSSYFVEWIPNNVK; GHYTEGAELVDSVLDVVR; LAVNMVPFPR; SGPFGQIFRPDNFVFGQSGAGNNWAK; EIVHIQAGQCGNQIGAK; PDNFVFGQSGAGNNWAK; ISEQFTAMFR; TAVCDIPPR; FPGQLNADLR; NMMAACDPR; KLAVNMVPFPR; LTTPTYGDLNHLVSATMSGVTTCLR; MSATFIGNSTAIQELFK; MSATFIGNSTAIQELFKR; MREIVHIQAGQCGNQIGAK; EIVHLQAGQCGNQIGAK; LHFFMPGFAPLTSR; EAESCDCLQGFQLTHSLGGGTGSGMGTLLISK; AVLVDLEPGTMDSVR; YLTVAAVFR; ALTVPELTQQMFDAK; IMNTFSVVPSPK; FWEVISDEHGIDPTGTYHGDSDLQLER; INVYYNEATGGK; IREEYPDR; PMF; Comb 1 IPI00007752.1
139 S_Total95_38 IPI00549172.2 |TREMBL:Q8N6N5; Q8IZ29; Q8IWP6 |H-INV:HIT000003035; HIT000040807; HIT000009883; HIT000020057 Tax_Id=9606 Class IVb beta tubulin 27 EVDEQMLNVQNK; NSSYFVEWIPNNVK; GHYTEGAELVDSVLDVVR; LAVNMVPFPR; SGPFGQIFRPDNFVFGQSGAGNNWAK; EIVHIQAGQCGNQIGAK; PDNFVFGQSGAGNNWAK; ISEQFTAMFR; TAVCDIPPR; FPGQLNADLR; NMMAACDPR; KLAVNMVPFPR; LTTPTYGDLNHLVSATMSGVTTCLR; MREIVHIQAGQCGNQIGAK; EIVHLQAGQCGNQIGAK; LHFFMPGFAPLTSR; EAESCDCLQGFQLTHSLGGGTGSGMGTLLISK; AVLVDLEPGTMDSVR; YLTVAAVFR; ALTVPELTQQMFDAK; IMNTFSVVPSPK; FWEVISDEHGIDPTGTYHGDSDLQLER; INVYYNEATGGK; MPATFIGNSTAIQELFK; MPATFIGNSTAIQELFKR; IREEYPDR; PMF; Comb 1 IPI00549172.2
140 S_Total95_130 IPI00008934.1 |SWISS-PROT:P54868 |TREMBL:Q6IBF4; Q5SZU2 |REFSEQ_NP:NP_005509 |ENSEMBL:ENSP00000256633 Tax_Id=9606 Hydroxymethylglutaryl-CoA synthase, mitochondrial precursor 27 GLEAFGGLK; LEVGTETIIDK; LEDTYTNKDLDK; PTGGAGAVAMLIGPK; VSQDAAPGSPLDK; IQLPWDSVGR; DVGILALEVYFPAQYVDQTDLEK; IGAFSYGSGLAASFFSFR; LMFNDFLSASSDTQTSLYK; LVSSTSDLPK; VNFSPPGDTNSLFPGTWYLER; LSIQCYLR; CVSPEEFTEIMNQR; LVSSTSDLPKR; MGFCSVQEDINSLCLTVVQR; YTVGLGQTR; KCVSPEEFTEIMNQR; LEDTYTNK; YAMVVCGDIAVYPSGNAR; PNLASEYPIVDGK; GTHMENVYDFYK; GTHMENVYDFYKPNLASEYPIVDGK; IGAFSYGSGLAASFFSFRVSQDAAPGSPLDK; VSQDAAPGSPLDKLVSSTSDLPK; QAGSDRPFTLDDLQYMIFHTPFCK; VDEQHRR; Comb; PMF 1 IPI00008934.1
141 S_Total95_194 IPI00294578.1 |SWISS-PROT:P21980-1 |TREMBL:Q6B838; Q6DKH2; Q6ZTL3 |REFSEQ_NP:NP_004604 |ENSEMBL:ENSP00000355330 |H-INV:HIT000014637 Tax_Id=9606 Splice Isoform 1 of Protein-glutamine gamma-glutamyltransferase 27 DCLTESNLIK; DLYLENPEIK; LVVNFESDK; LVVNFESDKLK; NEFGEIQGDK; SEGTYCCGPVPVR; TVSYNGILGPECGTK; YLLNLNLEPFSEK; ALLVEPVINSYLLAER; CDLELETNGR; GQPFWLTLHFEGR; NYEASVDSLTFSVVTGPAPSQEAGTK; TVEIPDPVEAGEEVK; VVTNYNSAHDQNSNLLIEYFR; YDAPFVFAEVNADVVDWIQQDDGSVHK; YGQCWVFAAVACTVLR; YRDCLTESNLIK; VVSGMVNCNDDQGVLLGR; QEYVLTQQGFIYQGSAK; SVPLCILYEK; MDLLPLHMGLHK; WDNNYGDGVSPMSWIGSVDILR; PDLQPGYEGWQALDPTPQEK; LVAEVSLQNPLPVALEGCTFTVEGAGLTEEQK; SINRSLIVGLKISTK; DAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYR; Comb; PMF 1 IPI00294578.1
142 S_Total95_207 IPI00333771.1 |SWISS-PROT:Q05682-5 |TREMBL:Q7Z2Y9; Q6PJM5; Q6P707; Q9UD91 |REFSEQ_NP:NP_149131 |ENSEMBL:ENSP00000350106 Tax_Id=9606 Splice Isoform 5 of Caldesmon 27 LEQYTSAIEGTK; YEIEETETVTK; EFDPTITDASLSLPSR; GNVFSSPTAAGTPNK; TTTTNTQVEGDDEAAFLER; QQEAALELEELKK; SAKPTKPAASDLPVPAEGVR; RSLAALSQIAYQR; SLAALSQIAYQR; PGDVSSKRNLWEK; QKEFDPTITDASLSLPSR; QKMPEDGLSDDKK; EAEGAPQVEAGK; MPEDGLSDDK; MPEDGLSDDKKPFK; PTKPAASDLPVPAEGVR; QEEESLGQVTDQVEVNAQNSVPDEEAK; QQEAALELEELK; VLEEEEQR; GETESEEFEK; GSIGENQIKDEK; MQNDTAENETTEK; MQNDTAENETTEKEEK; RGETESEEFEK; QKQEEESLGQVTDQVEVNAQNSVPDEEAK; SPAPKPSDLRPGDVSSK; Comb; PMF 1 IPI00333771.1
143 S_Total95_211 IPI00440493.2 |SWISS-PROT:P25705 |TREMBL:Q53XX6 |REFSEQ_NP:NP_004037; NP_001001937 |ENSEMBL:ENSP00000282050 |H-INV:HIT000038628; HIT000037463; HIT000023595 Tax_Id=9606 ATP synthase alpha chain, mitochondrial precursor 27 EAYPGDVFYLHSR; HALIIYDDLSK; ILGADTSVDLEETGR; TSIAIDTIINQK; VVDALGNAIDGK; GYLDKLEPSK; AVDSLVPIGR; TGAIVDVPVGEELLGR; EVAAFAQFGSDLDAATQQLLSR; LKEIVTNFLAGFEA; VLSIGDGIAR; EIVTNFLAGFEA; GIRPAINVGLSVSR; GMSLNLEPDNVGVVVFGNDK; QGQYSPMAIEEQVAVIYAGVR; TGTAEMSSILEER; NVQAEEMVEFSSGLK; PAINVGLSVSR; VVDALGNAIDGKGPIGSK; TSIAIDTIINQKR; LELAQYR; AVDSLVPIGRGQRELIIGDR; QTGKTSIAIDTIINQK; VGLKAPGIIPR; FENAFLSHVVSQHQALLGTIR; ADGKISEQSDAKLK; PMF; Comb 1 IPI00440493.2
144 S_Total95_565 IPI00218407.5 |SWISS-PROT:P05062 |TREMBL:Q8NHT3; Q5T7D6 |REFSEQ_NP:NP_000026 |ENSEMBL:ENSP00000259398 |H-INV:HIT000040746 Tax_Id=9606 Fructose-bisphosphate aldolase B 27 ALQASALAAWGGK; EATQEAFMK; ELSEIAQSIVANGK; ETTIQGLDGLSER; FPALTQEQK; GILAADESVGTMGNR; LDQGGAPLAGTNK; KELSEIAQSIVANGK; IADQCPSSLAIQENANALAR; YTPEQVAMATVTALHR; GQYVHTGSSGAASTQSLFTACYTY; ALNDHHVYLEGTLLKPNMVTAGHACTK; EILFSVDSSINQSIGGVILFHETLYQK; FPALTQEQKK; IKVENTEENRR; PNMVTAGHACTK; KYTPEQVAMATVTALHR; AMANCQAAK; IKVENTEENR; TVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPK; YASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEK; LDQGGAPLAGTNKETTIQGLDGLSER; AANKEATQEAFMKR; TVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWK; ALNDHHVYLEGTLLK; LSFSYGR; PMF; Comb 1 IPI00218407.5
145 S_Total95_785 IPI00013933.1 |SWISS-PROT:P15924-1 |REFSEQ_NP:NP_004406 |ENSEMBL:ENSP00000211979 Tax_Id=9606 Splice Isoform DPI of Desmoplakin 27 ITNLTQQLEQASIVK; QMGQPCDAYQKRLLQLQEQMR; AELIVQPELK; GFFDPNTEENLTYLQLK; GYFNEELSEILSDPSDDTK; NNYDEEIISLK; QLQNIIQATSR; SAIYQLEEEYENLLK; TGSQYDIQDAIDK; ETQSQLETER; GLPSPYNMSSAPGSR; IKDFLQGSSCIAGIYNETTK; LNDSILQATEQR; NTLTQTTENLR; SVQNDSQAIAEVLNQLK; TLELQGLINDLQR; ETQTECEWTVDTSK; GIVDSITGQR; NQFETEINITK; FDQQKNDYDQLQK; IEVLEEELR; NQCTQVVQER; ALLQAILQTEDMLK; SGSLSLTQFADMISLK; NGVGTSSSMGSGVSDDVFSSSR; LLEAQIASGGVVDPVNSVFLPK; Comb; PMF 1 IPI00013933.1
146 S_Total95_1031 IPI00000877.1 |SWISS-PROT:Q9Y4L1 |TREMBL:Q6IN67; Q53H25; Q68D25; Q9BST8 |REFSEQ_NP:NP_006380 |ENSEMBL:ENSP00000278752 |H-INV:HIT000032024 Tax_Id=9606 150 kDa oxygen-regulated protein precursor 27 LGNTISSLFGGGTTPDAK; LPATEKPVLLSK; VESVFETLVEDSAEEESTLTK; AEAGPEGVAPAPEGEK; LYQPEYQEVSTEEQR; VLQLINDNTATALSYGVFR; DAVITVPVFFNQAER; EEAEAPVEDGSQPPPPEPK; KTPVIVTLKENER; LAGLFNEQR; SLAEDFAEQPIK; VEFEELCADLFER; AANSLEAFIFETQDK; KLCQGLFFR; LCQGLFFR; LIPEMDQIFTEVEMTTLEK; DEPGEQVELK; ENGTDTVQEEEESPAEGSK; LSAASTWLEDEGVGATTVMLK; NINADEAAAMGAVYQAAALSK; PGVPMEIVLNK; VETGSEPGDTEPLELGGPGAEPEQK; VAIVKPGVPMEIVLNK; DEPGEQVELKEEAEAPVEDGSQPPPPEPK; VIPPAGQTEDAEPISEPEK; LYQPEYQEVSTEEQREEISGK; Comb; PMF 1 IPI00000877.1
147 S_Total95_2540 IPI00334599.5 |TREMBL:O75202 |REFSEQ_NP:NP_001010845 |ENSEMBL:ENSP00000219054 |H-INV:HIT000012481; HIT000016745; HIT000020894 Tax_Id=9606 HypotHetical protein LOC123876 27 ADDIINSSGYR; AIVAGDEVIQEVDTVASECPSLR; ELSENSQQAANVLSGACGLQR; FDPLVILK; GDFWLLGDR; GNVLPPGTEGDIGIR; KIEFVLNLPK; LPSPALWWVNGK; GKELMWNFR; ESYGQTETGLTCMVSK; SCDGWLNFK; AFVVLASQFLSHDPEQLTK; DEDGYFQFMGR; FNFASDVLDHWADMEK; RLPSPALWWVNGK; AGLIFMPGTIQMK; MLLQQDLSSYK; MAEHSYSSLGLK; SMMGAPIVYR; VKPIRPIGIFSGYVDNPDK; IEFVLNLPK; GIKDEDGYFQFMGR; PIGIFSGYVDNPDK; LLNEASTTHHCVETGSQEASAIYFTSGTSGLPK; FPHLQNCVTVGESLLPETLENWR; IGPSEVENALMEHPAVVETAVISSPDPVR; SVTAPYKYPR 1 IPI00334599.5
148 S_Total95_3660 IPI00337736.1 |SWISS-PROT:Q86UP2-2 |TREMBL:Q6NZ46; Q6PDF7 |ENSEMBL:ENSP00000334083 |H-INV:HIT000042142 Tax_Id=9606 Splice Isoform 2 of Kinectin 27 ALKEEIGNVQLEK; GELTTLIHQLQEK; SVEELLEAELLK; VQELQNLLK; LQALANEQAAAAHELEK; TQLLQDVQDENK; TVEELLETGLIQVATK; AAGDTTVIENSDVSPETESSEK; DAVSNTTNQLESK; QQQVEAVELEAK; TETDKENAEVK; EISGLWNELDSLK; TQLLQDVQDENKLFK; AQQSLELIQSK; EASSASQFEELEIVLK; EESLQMQVQDILEQNEALK; LQTLVSEQPNK; LSDALAVEDDQVAPVPLNVVETSSSVR; QNDQVSFASLVEELK; SVLAETEGILQK; VSVPSNLSYGEWLHGFEK; EVIDLLKPDQVEGIQK; QNDQVSFASLVEELKK; AQIQQFHSQIAAQTSASVLAEELHK; ETMSVSLNQTVTQLQQLLQAVNQQLTK; NNERQQQVEAVELEAK; TENVFVDEPLIHATTYIPLMDNADSSPVVDK 1 IPI00337736.1
149 S_Total95_5653 IPI00304589.3 |SWISS-PROT:Q9C0C2 |TREMBL:Q6PJ35 |REFSEQ_NP:NP_203754 |ENSEMBL:ENSP00000322446; ENSP00000350990 |H-INV:HIT000001457; HIT000014893 Tax_Id=9606 182 kDa tankyrase 1-binding protein 27 RPLPFAPR; AAEPQEQEFGK; DAELQDQEFGK; DVSLGDWEFGK; ESGVGQTDWSGVEAGEFLK; DLEVTCDPDSGGSQGLR; EAAFSPGQQDWSR; DSLGAYASQDANEQGQDLGK; SSGSEGSSPNWLQALK; NMAPGAVCSPGESK; DLAEVGEGGGHSQAR; PSLLVPVGPRPPR; VNLFPGLSPSALK; VSAPGVLTAQDR; DMNLTGCLESGGSEEPGGIGVGEK; EHGVGGVSQCPEPGLR; EMEEELVPTGSEPGDTR; FAATTVEEILAK; FSEGVLQSPSQDQEK; GVGQADWTPDLGLR; PAVEASTGGEATQETGK; PLIEVGELLDLTR; PLSSGFSPEEAQQQDEEFEK; SAEEGELAESK; WSDQGPAQTSR; DLQSEFGITGDPQPSSFSPSSWCQGASQDYGLGGASPR; YESQEPLAGQESPLPLATR 1 IPI00304589.3
150 S_Total95_25 IPI00104341.3 |SWISS-PROT:P34913 |REFSEQ_NP:NP_001970 |ENSEMBL:ENSP00000315621 |H-INV:HIT000019248; HIT000036381; HIT000021625; HIT000035339; HIT000020944; HIT000033392 Tax_Id=9606 Epoxide hydrolase 2 26 YQIPALAQAGYR; AAVFDLDGVLALPAVFGVLGR; DLGMVTILVQDTDTALKELEK; ANPVFDYQLYFQEPGVAEAELEQNLSR; ASPSEVVFLDDIGANLKPAR; FLLDTLK; GFTTAILTNTWLDDR; TEEALALPR; VCEAGGLFVNSPEEPSLSR; ASPSEVVFLDDIGANLK; AVASLNTPFIPANPNMSPLESIK; DLGMVTILVQDTDTALK; GLLNDAFQK; GEITLSQWIPLMEENCR; ASDESVLSMHK; DGLAQLMCELK; GPLNWYR; GYGESSAPPEIEEYCMEVLCK; ILIPALMVTAEK; MVTEEEIQFYVQQFK; INRPMLQAALMLR; LHFVELGSGPAVCLCHGFPESWYSWR; VTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPR; VTGIQLLNTPAPLPTSCNPSDMSHGYVTVK; GHIEDCGHWTQMDKPTEVNQILIK; Comb 1 IPI00104341.3
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home