Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
151 S_Total95_85 IPI00465248.4 |SWISS-PROT:P06733 |TREMBL:Q9UCH6; Q53FT9; Q96GV1; Q9BT62; Q53HR3 |REFSEQ_NP:NP_001419 |ENSEMBL:ENSP00000234590; ENSP00000351745 |H-INV:HIT000035186; HIT000034664; HIT000031962; HIT000030666; HIT000015459; HIT000037234; HIT000028653; HIT000023250; HIT000040307; HIT000039619 Tax_Id=9606 Alpha enolase 26 YISPDQLADLYK; GNPTVEVDLFTSK; IGAEVYHNLK; LMIEMDGTENK; AAVPSGASTGIYEALELR; DATNVGDEGGFAPNILENK; FTASAGIQVVGDDLTVTNPK; SGETEDTFIADLVVGLCTGQIK; VNQIGSVTESIQACK; VVIGMDVAASEFFR; DYPVVSIEDPFDQDDWGAWQK; FGANAILGVSLAVCK; LNVTEQEKIDK; SCNCLLLK; DATNVGDEGGFAPNILENKEGLELLK; YDLDFKSPDDPSR; LAMQEFMILPVGAANFR; LAQANGWGVMVSHR; LNVTEQEK; HIADLAGNSEVILPVPAFNVINGGSHAGNK; KLNVTEQEKIDK; SFIKDYPVVSIEDPFDQDDWGAWQK; EIFDSRGNPTVEVDLFTSK; AVEHINKTIAPALVSK; EGLELLK; PMF; Comb 1 IPI00465248.4
152 S_Total95_144 IPI00218899.2 |SWISS-PROT:P08319 |TREMBL:Q8TCD7 |REFSEQ_NP:NP_000661 |ENSEMBL:ENSP00000265512 |H-INV:HIT000039467 Tax_Id=9606 Alcohol dehydrogenase class II pi chain precursor 26 VTPGSTCAVFGLGGVGLSAVMGCK; IIGIDINSEK; FCLSPLTNLCGK; IDDDANLER; ISEAFDLMNQGK; PLCIEEVEVAPPK; SPASDQQLMEDK; TINGTFFGGWK; VIPLYAPLCR; ALGATDCLNPR; FNLDALVTHTLPFDK; GGVDFALDCAGGSETMK; AAIAWEAGKPLCIEEVEVAPPK; AALDCTTAGWGSCTFIGVAAGSK; DLHKPIQEVIIELTK; FEGLAFPVIVGHEAAGIVESIGPGVTNVK; FEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDK; KFNLDALVTHTLPFDK; VCLLGCGFSTGYGAAINNAK; GKPVYHFFGTSTFSQYTVVSDINLAK; AAIAWEAGK; PIQEVIIELTK; IDDDANLERVCLLGCGFSTGYGAAINNAK; ISNLKSPASDQQLMEDK; CKFCLSPLTNLCGK; PMF; Comb 1 IPI00218899.2
153 S_Total95_184 IPI00551024.3 |TREMBL:Q53EQ9; Q9BVA7; Q9UFX5 |REFSEQ_NP:NP_056348 |ENSEMBL:ENSP00000310493; ENSP00000351874 |H-INV:HIT000024524; HIT000030329 Tax_Id=9606 DKFZP586B1621 protein variant 26 EGPPPASPAQLLSK; SPGADLLQVLTK; VAGALAEAGVGLEEIAK; ASYISSAR; AVAQAGTVGTLLIVK; LEQPDPGAVAAAAILR; MGGSSGALYGLFLTAAAQPLK; GLCGTVLIHK; VALLSGGGSGHEPAHAGFIGK; AEGIPVEMVVIGDDSAFTVLK; LIDAETTAAAWPNVAAVSITGR; LSVLLLEK; VAPAEPQEAPDSTAAGGSASK; VCSTLLGLEEHLNALDR; TMLDSLWAAGQELQAWK; AILEVLQS; TSLPAWSAAMDAGLEAMQK; AMGTLGVSLSSCSVPGSK; GMLTGVIAGAVFTSPAVGSILAAIR; RGLCGTVLIHK; MGGSSGALYGLFLTAAAQPLKAK; PTFELSADEVELGLGIHGEAGVR; RMALVLERVCSTLLGLEEHLNALDR; VAPAEPQEAPDSTAAGGSASKR; NYTGDRLNFGLAR; Comb; PMF 1 IPI00551024.3
154 S_Total95_287 IPI00329331.4 |SWISS-PROT:Q16851-1 |TREMBL:Q53QE9 |REFSEQ_NP:NP_006750 |ENSEMBL:ENSP00000338703 |H-INV:HIT000031313 Tax_Id=9606 Hypothetical protein UGP2 26 EFPTVPLVK; GLPDNISSVLNK; LVEIAQVPK; SFENSLGINVPR; ESLLPVAK; IQRPPEDSIQPYEK; NENTFLDLTVQQIEHLNK; TLDGGLNVIQLETAVGAAIK; ILTTASSHEFEHTK; REFPTVPLVK; IFNTNNLWISLAAVK; TTSDLLLVMSNLYSLNAGSLTMSEK; TYNTDVPLVLMNSFNTDEDTKK; IYTFNQSR; FLQEKGPSVDWGK; TYNTDVPLVLMNSFNTDEDTK; CEFVMEVTNK; LNGGLGTSMGCK; LQEQNAIDMEIIVNAK; GGTLTQYEGK; RCEFVMEVTNK; DVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGK; TTSDLLLVMSNLYSLNAGSLTMSEKR; INKESLLPVAK; AMSQDGASQFQEVIR; PMF; Comb 1 IPI00329331.4
155 S_Total95_412 IPI00298057.1 |SWISS-PROT:O60437 |REFSEQ_NP:NP_002696 |ENSEMBL:ENSP00000340510 |H-INV:HIT000000285 Tax_Id=9606 Periplakin 26 DKDLEIDELQK; EVDPQVNWAALVEEK; STAEGEAFIQALPGSGTTPLLR; AITGILRPPLEQGR; EAEVLLLQQR; ICANSQQYQQAVK; LKNQKNLLDEIASR; NIVDTEAKMQSDLAR; TENPGDASDLQGR; VVLQQDPQQAR; NQLLQEELEALQLQLR; YEHLLQLLDLAQEK; ELSELIEQLQK; EVVQEILQFQEDPQTK; NLLDEIASR; SLLGEVEQNLQAAK; VLDKYEDVVQGLQK; VPDPVLEESFQQLQR; INKLHSEGDQLLAAEHPGR; LAALEQEEAEAR; LQNLEFALNLLR; QLLEGELETLR; ETPLKPIPVEALCDFEGEQGLISR; LQNDPQLEAEYQQLQEDHQR; LQLEEEQHRR; Comb; PMF 1 IPI00298057.1
156 S_Total95_680 IPI00033217.1 |SWISS-PROT:Q9UDR5 |REFSEQ_NP:NP_005754 |ENSEMBL:ENSP00000222418; ENSP00000351834 |H-INV:HIT000006720 Tax_Id=9606 Alpha-aminoadipic semialdehyde synthase, mitochondrial precursor 26 EALPAFRPEANPLTWK; FSPAGVEGCPALPHK; GAQAIFNELPCEYVEPHELK; KTDAVYDPAEYDKHPER; KTYAFFSHTIK; QDLVISLLPYVLHPLVAK; SIGPLTFVFTGTGNVSK; VLVLGSGYISEPVLEYLSR; DAVITSNGTLPDKYK; QLLCDLVGISPSSEHDVLK; YAEIYGISSAHTLLR; AEGIIYTTQSTIKP; AGGILQEDISEACLILGVK; DAVITSNGTLPDK; VNMVTASYITPALK; VYGTVLSR; NSSQAVQAVR; TDAVYDPAEYDK; AQEANMGLLDEILK; EIYGPILER; KYNINPVSMDICKQEEK; DAGYEISLGLMPK; KTDAVYDPAEYDK; VVNVAGGISFLDAVTSMDFFPGLNLEGYPNR; LGGDNTQLEAAEWLGLLGDEQVPQAESILDALSK; Comb; PMF 1 IPI00033217.1
157 S_Total95_730 IPI00604796.1 |TREMBL:Q53G38 |H-INV:HIT000029845; HIT000039066 Tax_Id=9606 Keratin 18 variant 26 IVLQIDNAR; AQIFANTVDNAR; DWSHYFK; LEAEIATYR; PVSSAASVYAGAGGSGSR; QAQEYEALLNIK; SLGSVQAPSYGAR; VKLEAEIATYR; VIDDTNITR; LASYLDR; TVQSLEIDLDSMR; GLQAQIASSGLTVEVDAPK; LLEDGEDFNLGDALDSSNSMQTIQK; QSVENDIHGLR; VKYETELAMR; LQLETEIEALK; GGMGSGGLATGIAGGLAGMGGIQNEK; YALQMEQLNGILLHLESELAQTR; LAADDFR; KVIDDTNITR; ASLENSLR; YETELAMR; YWSQQIEESTTVVTTQSAEVGAAETTLTELR; SLGSVQAPSYGARPVSSAASVYAGAGGSGSR; AQYDELAR; PMF; Comb 1 IPI00604796.1
158 S_Total95_2599 IPI00217872.2 |SWISS-PROT:P36871-2 |ENSEMBL:ENSP00000342316 Tax_Id=9606 Splice Isoform 2 of Phosphoglucomutase 26 IALYETPTGWK; TIEEYAVCPDLK; YDYEEVEAEGANK; DLEALMFDR; VDLGVLGK; ADNFEYSDPVDGSISR; FNISNGGPAPEAITDK; AIGGIILTASHNPGGPNGDFGIK; LSGTGSAGATIR; LVIGQNGILSTPAVSCIIR; INQDPQVMLAPLISIALK; LSLCGEESFGTGSDHIR; LYIDSYEK; LYIDSYEKDVAK; SGEHDFGAAFDGDGDR; SIFDFSALK; KQSVEDILK; LIFTDGSR; QFSANDKVYTVEK; HGFFVNPSDSVAVIAANIFSIPYFQQTGVR; FNISNGGPAPEAITDKIFQISK; DVAKINQDPQVMLAPLISIALKVSQLQER; ILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMK; FFGNLMDASK; DGLWAVLAWLSILATR; IDAMHGVVGPYVK 1 IPI00217872.2
159 S_Total95_3302 IPI00017601.1 |SWISS-PROT:P00450 |TREMBL:Q6NSB2 |REFSEQ_NP:NP_000087 |ENSEMBL:ENSP00000264613 |H-INV:HIT000020145 Tax_Id=9606 Ceruloplasmin precursor 26 DIFTGLIGPMK; DIASGLIGPLIICK; DLYSGLIGPLIVCR; EYTDASFTNR; GAYPLSIEPIGVR; PVWLGFLGPIIK; SGAGTEDSACIPWAYYSTVDQVK; TTIEKPVWLGFLGPIIK; VNKDDEEFIESNK; ALYLQYTDETFR; EVGPTNADPVCLAK; NNEGTYYSPNYNPQSR; PYTFHSHGITYYK; RQSEDSTFYLGER; AGLQAFFQVQECNK; VDKDNEDFQESNR; MYYSAVDPTK; DDEEFIESNK; EFYLFPTVFDENESLLLEDNIR; KAEEEHLGILGPQLHADVGDK; TYCSEPEKVDKDNEDFQESNR; HYYIGIIETTWDYASDHGEK; DVDKEFYLFPTVFDENESLLLEDNIR; ERGPEEEHLGILGPVIWAEVGDTIR; GPEEEHLGILGPVIWAEVGDTIR; AEEEHLGILGPQLHADVGDK 1 IPI00017601.1
160 S_Total95_3575 IPI00005158.1 |SWISS-PROT:P36776 |REFSEQ_NP:NP_004784 |ENSEMBL:ENSP00000353826 |H-INV:HIT000029449 Tax_Id=9606 Lon protease homolog, mitochondrial precursor 26 LSSDVLTLLIK; EIFDIAFPDEQAEALAVER; ELGLEKDDKDAIEEK; TENPLILIDEVDK; TKTENPLILIDEVDKIGR; VLFICTANVTDTIPEPLR; LAQPYVGVFLK; TIRDIIALNPLYR; YSNENLDLAR; QLEVEPEEPEAENK; DIIALNPLYR; ILEFIAVSQLR; HVMDVVDEELSK; ILCFYGPPGVGK; NYLDWLTSIPWGK; AGVTCIVLPAENK; DGPSAGCTIVTALLSLAMGR; DGSLEVTGQLGEVMK; IVSGEAESVEVTPENLQDFVGK; LGLLDNHSSEFNVTR; LQQRLGREVEEK; YLLQEQLKIIKK; GYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSK; IVSGEAESVEVTPENLQDFVGKPVFTVER; VVDNPIYLSDMGAALTGAESHELQDVLEETNIPK; TIRDIIALNPLYRESVLQMMQAGQR 2 IPI00005158.1, IPI00334291.5
161 S_Total95_3628 IPI00017030.10 |SWISS-PROT:Q92614-1 |TREMBL:Q5W9G1 |REFSEQ_NP:NP_510880 |ENSEMBL:ENSP00000346291 Tax_Id=9606 Splice Isoform 1 of Myosin XVIIIA 26 AAYLLGCSLEELSSAIFK; FDSELSQAHEEAQR; RFDSELSQAHEEAQR; AGSATVLSGSIAGLEGGSQLALR; GASFEELCHNYTQDR; NQLEESEFTCAAAVK; NTGESASQLLDAETAER; TEEQIAAEEAWNETEK; EKDMLLAEAFSLK; ISELTSELTDER; VDGVKSWLSKNK; SEELNLPEGK; ALLADAQLMLDHLK; ERMSAAELRSLEEMSLR; LQALQSQVEFLEQSMVDK; VVSLEAELQDISSQESK; AAEINGEVDDDDAGGEWR; DESASETSTPSEHSAAPSPQVEVR; DLAQINDLQAQLEEANK; LEEDQEDMNELMK; LEISNPIPIK; LPPVVPLPPPTLR; VVSLEAELQDISSQESKDEASLAK; DESASETSTPSEHSAAPSPQVEVRTLEGQLVQHPGPGIPR; KKHELEMDLESLEAANQSLQADLK; SRDESASETSTPSEHSAAPSPQVEVR 3 IPI00017030.10, IPI00402167.2, IPI00477329.1
162 S_Total95_4731 IPI00182540.4 |SWISS-PROT:O60716-1 |ENSEMBL:ENSP00000354823 Tax_Id=9606 Splice Isoform 1ABC of Catenin delta-1 26 FHPEPYGLEDDQR; GIPVLVGLLDHPKK; HAIPNLVK; LVENCVCLLR; NGNGGPGPYVGQAGTATLPR; SQSSHSYDDSTLPLIDR; AAALVLQTIWGYK; SNAAAYLQHLCYR; TPAILEASAGAIQNLCAGR; VGGSSVDLHR; KPIEDPANDTVDFPK; QDVYGPQPQVR; ALSAIADLLTNEHER; GIPVLVGLLDHPK; ECDGLVDALIFIVQAEIGQK; AASGALRNLAVDARNK; SDFQVNLNNASR; DFRKNGNGGPGPYVGQAGTATLPR; HIEWESVLTNTAGCLR; HYEDGYPGGSDNYGSLSR; SGDLGDMEPLK; SMGYDDLDYGMMSDYGTAR; TVQPVAMGPDGLPVDASSVSNNYIQTLGR; YQEAAPNVANNTGPHAASCFGAK; SYEDMIGEEVPSDQYYWAPLAQHER; SLDNNYSTPNER 12 IPI00182469.2, IPI00182540.4, IPI00219725.1, IPI00219726.1, IPI00219728.1, IPI00219733.1, IPI00219734.1, IPI00219735.1, IPI00219738.1, IPI00219868.1, IPI00219870.1, IPI00219875.1
163 S_Total95_1 IPI00025447.4 |SWISS-PROT:P68104 |TREMBL:Q6IPN6; Q96C29; Q96RE1; Q9NZS6; Q53HR1; Q16577; Q8TBL1; Q9H2I7; Q6IPS9; Q53GE9; Q6P4C9; Q53G85; Q96EB3; Q53GA1; Q53HQ7; Q6P082; Q53HM9; Q504Z0; Q5JR01; Q6IPT9; Q96CD8; Q53G89; Q8IUB0; Q53HR5; Q6IQ15 |REFSEQ_NP:NP_001393 |ENSEMBL:ENSP00000350920; ENSP00000310144 |H-INV:HIT000036019; HIT000023340; HIT000014769; HIT000014688; HIT000038298; HIT000033849; HIT000023453; HIT000023417; HIT000040601; HIT000034537; HIT000009924; HIT000035058; HIT000023348; HIT000011672; HIT000036587; HIT000034635; HIT000038378; HIT000002443; HIT000008162; HIT000039249 Tax_Id=9606 Elongation factor 1-alpha 1 25 EHALLAYTLGVK; IGGIGTVPVGR; LPLQDVYK; QLIVGVNK; NMITGTSQADCAVLIVAAGVGEFEAGISK; NGQTREHALLAYTLGVK; QTVAVGVIK; PMCVESFSDYPPLGR; VETGVLKPGMVVTFAPVNVTTEVK; PGMVVTFAPVNVTTEVK; YYVTIIDAPGHR; THINIVVIGHVDSGK; DGNASGTTLLEALDCILPPTRPTDK; DGNASGTTLLEALDCILPPTR; STTTGHLIYK; MDSTEPPYSQK; IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK; YYVTIIDAPGHRDFIK; KDGNASGTTLLEALDCILPPTR; DGNASGTTLLEALDCILPPTRPTDKPLR; KDGNASGTTLLEALDCILPPTRPTDK; SGDAAIVDMVPGK; SGDAAIVDMVPGKPMCVESFSDYPPLGR; THINIVVIGHVDSGKSTTTGHLIYK; Comb; PMF 2 IPI00472724.1, IPI00025447.4
164 S_Total95_20 IPI00002519.1 |SWISS-PROT:P34896-1 |TREMBL:Q53ET7; Q96HY0 |REFSEQ_NP:NP_004160 |ENSEMBL:ENSP00000318868 Tax_Id=9606 Splice Isoform 1 of Serine hydroxymethyltransferase, cytosolic 25 EEVESFASLFPLPGLPDF; AVLEALGSCLNNK; DSDVEVYNIIK; LIIAGTSCYSR; VLEACSIACNK; ISATSIFFESMPYK; GIELTLQIQSDTGVR; VNPDTGYINYDQLEENAR; YQAAVQALR; YSEGYPGKR; YYGGTEFIDELETLCQK; DADLWSSHDK; KISATSIFFESMPYK; MLAQPLKDSDVEVYNIIK; VGLELIASENFASR; LAGDKYQAAVQALR; LGTPALTSR; IMGLDLPDGGHLTHGFMTDK; LDPQCWGVNVQPYSGSPANFAVYTALVEPHGR; ALSEALTELGYK; IVTGGSDNHLILVDLR; VYQHQVVANCR; EILYNLESLINSAVFPGLQGGPHNHAIAGVAVALK; YSEGYPGQR; PMF; Comb 1 IPI00002519.1
165 S_Total95_37 IPI00013475.1 |TREMBL:Q13885 |REFSEQ_NP:NP_001060 |ENSEMBL:ENSP00000259799 |H-INV:HIT000038454 Tax_Id=9606 Beta tubulin 25 INVYYNEAAGNK; EVDEQMLNVQNK; NSSYFVEWIPNNVK; GHYTEGAELVDSVLDVVR; LAVNMVPFPR; SGPFGQIFRPDNFVFGQSGAGNNWAK; AILVDLEPGTMDSVR; EIVHIQAGQCGNQIGAK; PDNFVFGQSGAGNNWAK; YLTVAAIFR; ISEQFTAMFR; TAVCDIPPR; FPGQLNADLR; NMMAACDPR; ALTVPELTQQMFDSK; KLAVNMVPFPR; LTTPTYGDLNHLVSATMSGVTTCLR; MSATFIGNSTAIQELFK; MSATFIGNSTAIQELFKR; MREIVHIQAGQCGNQIGAK; FWEVISDEHGIDPTGSYHGDSDLQLER; EIVHLQAGQCGNQIGAK; LHFFMPGFAPLTSR; IREEYPDR; Comb; PMF 1 IPI00013475.1
166 S_Total95_39 IPI00031370.3 |TREMBL:O43209; Q9UGA2; Q9BVA1 |REFSEQ_NP:NP_821080 |ENSEMBL:ENSP00000259818 |H-INV:HIT000030338; HIT000023946; HIT000023516 Tax_Id=9606 Tubulin, beta polypeptide paralog 25 EVDEQMLNVQNK; NSSYFVEWIPNNVK; GHYTEGAELVDSVLDVVR; LAVNMVPFPR; SGPFGQIFRPDNFVFGQSGAGNNWAK; AILVDLEPGTMDSVR; EIVHIQAGQCGNQIGAK; PDNFVFGQSGAGNNWAK; YLTVAAIFR; ISEQFTAMFR; TAVCDIPPR; FPGQLNADLR; NMMAACDPR; ALTVPELTQQMFDSK; KLAVNMVPFPR; LTTPTYGDLNHLVSATMSGVTTCLR; MSATFIGNSTAIQELFK; MSATFIGNSTAIQELFKR; MREIVHIQAGQCGNQIGAK; FWEVISDEHGIDPTGSYHGDSDLQLER; EIVHLQAGQCGNQIGAK; LHFFMPGFAPLTSR; INVYYNEATGNK; IREEYPDR; Comb; PMF 1 IPI00031370.3
167 S_Total95_186 IPI00217871.4 |SWISS-PROT:P30038 |TREMBL:Q53HU4; Q5TF55; Q5JNV6 |REFSEQ_NP:NP_003739; NP_733844 |ENSEMBL:ENSP00000336944; ENSP00000290597 |H-INV:HIT000033313 Tax_Id=9606 Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial precursor 25 NAAGNFYINDK; SADVESVVSGTLR; STGSIVGQQPFGGAR; TVIQAEIDAAAELIDFFR; VANEPVLAFTQGSPER; VGDPAEDFGTFFSAVIDAK; ETLQLVDSTTSYGLTGAVFSQDK; ASGTNDKPGGPHYILR; CDDSVGYFVEPCIVESK; EEIFGPVLSVYVYPDDK; EEIFGPVLSVYVYPDDKYK; KEWDLKPIADR; LYVPHSLWPQIK; SSPSLTILAGGK; WTSPQVIK; YAVELEGQQPISVPPSTNSTVYR; ETHKPLGDWSYAYMQ; AIEAALAAR; PGGPHYILR; AEILAKTMVGQGK; EAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFK; ETLQLVDSTTSYGLTGAVFSQDKDVVQEATK; YKETLQLVDSTTSYGLTGAVFSQDKDVVQEATK; EWDLKPIADR; PMF; Comb 1 IPI00217871.4
168 S_Total95_188 IPI00329033.5 |SWISS-PROT:P31513 |TREMBL:Q53FW5 |REFSEQ_NP:NP_008825; NP_001002294 |ENSEMBL:ENSP00000008553 |H-INV:HIT000041413 Tax_Id=9606 Dimethylaniline monooxygenase [N-oxide-forming] 3 25 IQEYIIAFAK; LVGPGQWPGAR; ESFPGLNHFK; NAILTQWDR; VAIIGAGVSGLASIR; HPDFATTGQWDVTTER; VLVVGLGNSGCDIATELSR; DYKEPGVFNGK; EPVFNDELPASILCGIVSVKPNVK; NNLPTAISDWLYVK; PNIPWLFLTDPK; SCLEEGLEPTCFEK; SETIQTDYIVYMDELSSFIGAK; STIAVIGFVQSLGAAIPTVDLQSR; NNEIILFK; SNDIGGLWK; GTCTLPSMEDMMNDINEK; HENYGLMPLNGVLR; LAMEVYFGPCSPYQFR; TAEQVMISSR; VWDNGYPWDMLLVTR; EMMCFPDFPFPDDFPNFMHNSK; ESAVFDAVMVCSGHHVYPNLPK; KEPVFNDELPASILCGIVSVKPNVK; PMF; Comb 1 IPI00329033.5
169 S_Total95_216 IPI00020984.1 |SWISS-PROT:P27824 |REFSEQ_NP:NP_001737 |ENSEMBL:ENSP00000247461 |H-INV:HIT000031590 Tax_Id=9606 Calnexin precursor 25 TPELNLDQFHDK; IPDPEAVKPDDWDEDAPAK; CESAPGCGVWQR; PEDWDERPKIPDPEAVK; TPYTIMFGPDK; KPEDWDERPK; LNKPFLFDTK; LNKPFLFDTKPLIVQYEVNFQNGIECGGAYVK; APVPTGEVYFADSFDR; GTLSGWILSK; DKGDEEEEGEEKLEEK; IVDDWANDGWGLKK; KIPNPDFFEDLEPFR; GDEEEEGEEKLEEK; SDAEEDGGTVSQEEEDRKPK; WKPPMIDNPSYQGIWKPR; IPNPDFFEDLEPFR; IVDDWANDGWGLK; SDAEEDGGTVSQEEEDR; AEEDEILNR; PVIDNPNYK; WKPPMIDNPSYQGIWK; TDAPQPDVKEEEEEKEEEK; CESAPGCGVWQRPVIDNPNYK; Comb; PMF 1 IPI00020984.1
170 S_Total95_463 IPI00221234.4 |SWISS-PROT:P49419 |TREMBL:Q6IPU8 |REFSEQ_NP:NP_001173 |ENSEMBL:ENSP00000297542 |H-INV:HIT000030956; HIT000017374 Tax_Id=9606 Aldehyde dehydrogenase family 7 member A1 25 DLPLAQGIK; IWADIPAPK; MIGGPILPSER; VNLLSFTGSTQVGK; QGLSSSIFTK; QASVADYEETVK; IQVLGSLVSLEMGK; GSDCGIVNVNIPTSGAEIGGAFGGEK; EENEGVYNGSWGGR; GEVITTYCPANNEPIAR; ILVEGVGEVQEYVDICDYAVGLSR; QASVADYEETVKK; VGNPWDPNVLYGPLHTK; FQNEEEVFAWNNEVK; GAPTTSLISVAVTK; QAVSMFLGAVEEAK; QAVSMFLGAVEEAKK; STLLINQPQYAWLK; QVGLMVQER; LFIHESIHDEVVNR; LPGAICSLTCGGADIGTAMAK; SLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQR; VMDRPGNYVEPTIVTGLGHDASIAHTETFAPILYVFK; VLEDNKLPGAICSLTCGGADIGTAMAK; PMF; Comb 1 IPI00221234.4
171 S_Total95_1071 IPI00022970.3 |SWISS-PROT:P12270 |TREMBL:Q5SWY0; Q504U6; Q9UE33; Q15624; Q99968; Q58F23 |REFSEQ_NP:NP_003283 |ENSEMBL:ENSP00000264142 |H-INV:HIT000006385 Tax_Id=9606 Translocated promoter region 25 AIQDHLLEVEQSK; ELENANDLLSATK; GQNLLLTNLQTIQGILER; INKYLDEIVKEVEAK; NLQEQTVQLQSELSR; FLADQQSEIDGLK; LSQELEYLTEDVKR; MEIQVKDLSQQIR; RPPHPLPPR; GAILSEEELAAMSPTAAAVAK; LTELYNAYVETQDQLLLEK; TLSSVQNEVQEALQR; TSTSNVEQYQAMVTSLEESLNK; VESEQQYFEIEK; VTAAAMAGNKSTPRASIR; ELQELQDSLNAER; FEVAQVESLR; KLELDILPLQEANAELSEK; LTIHAPPQELGPPVQR; VLLMELEEAR; NIEELQQQNQRLLVALR; QITLKTTPASGERGIASTSDPPTANIK; RPSTSQTVSTPAPVPVIESTEAIEAK; QSVGRGLQLTPGIGGMQQHFFDDEDR; Comb; PMF 1 IPI00022970.3
172 S_Total95_1119 IPI00305166.1 |SWISS-PROT:P31040 |TREMBL:Q59GW8 |REFSEQ_NP:NP_004159 |ENSEMBL:ENSP00000264932 |H-INV:HIT000030364; HIT000019734 Tax_Id=9606 Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial precursor 25 GEGGILINSQGER; TGHSILHTLYGR; HTLSYVDVGTGK; DLASRDVVSR; KHTLSYVDVGTGK; WHFYDTVK; TLNEADCATVPPAIR; VGSVLQEGCGK; VGSVLQEGCGKISK; KPFEEHWR; IDEYDYSKPIQGQQK; AAFGLSEAGFNTACVTK; VTLEYRPVIDK; ACALSIEESCRPGDK; LGANSLLDLVVFGR; LPGISETAMIFAGVDVTK; VPPIKPNAGEESVMNLDK; AGLPCQDLEFVQFHPTGIYGAGCLITEGCR; HVNGQDQIVPGLYACGEAACASVHGANR; VSDSISAQYPVVDHEFDAVVVGAGGAGLR; DHVYLQLHHLPPEQLATR; NTVVATGGYGR; GVIALCIEDGSIHR; TYFSCTSAHTSTGDGTAMITR; Comb; PMF 1 IPI00305166.1
173 S_Total95_1241 IPI00177728.3 |SWISS-PROT:Q96KP4 |REFSEQ_NP:NP_060705 |ENSEMBL:ENSP00000325548 |H-INV:HIT000007745 Tax_Id=9606 Cytosolic nonspecific dipeptidase 25 DVGAQILLHSHK; TGQEIPVNVR; GSTDDKGPVAGWINALEAYQK; LYDDIDFDIEEFAK; YPSLSLHGIEGAFSGSGAK; DVDYVCISDNYWLGK; GNILIPGINEAVAAVTEEEHK; GPVAGWINALEAYQK; FCLEGMEESGSEGLDELIFAR; DLHSGVYGGSVHEAMTDLILLMGSLVDK; DLHSGVYGGSVHEAMTDLILLMGSLVDKR; WRYPSLSLHGIEGAFSGSGAK; WVAIQSVSAWPEK; TVFGVEPDLTR; EGGSIPVTLTFQEATGK; LPDGSEIPLPPILLGR; LVPNMTPEVVGEQVTSYLTK; QKLPDGSEIPLPPILLGR; QLGGSVELVDIGK; MMEVAAADVK; NVMLLPVGSADDGAHSQNEK; PWVSDFSHPHYLAGR; VYMGHGGKPWVSDFSHPHYLAGR; WVAIQSVSAWPEKR; Comb; PMF 1 IPI00177728.3
174 S_Total95_1596 IPI00098902.3 |SWISS-PROT:Q02218 |TREMBL:Q9UDX0 |REFSEQ_NP:NP_002532 |ENSEMBL:ENSP00000222673 |H-INV:HIT000036814; HIT000032115 Tax_Id=9606 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor 25 DVVVDLVCYR; KPLIIFTPK; GRLNVLANVIR; LNVLANVIR; TVDWALAEYMAFGSLLK; LEAADEGSGDVK; LVEDHLAVQSLIR; LGFYGLDESDLDK; NTNAGAPPGTAYQSPLPLSR; ELEQIFCQFDSK; FGLEGCEVLIPALK; KELEQIFCQFDSK; GHHVAQLDPLGILDADLDSSVPADIISSTDK; VFHLPTTTFIGGQESALPLR; IEQLSPFPFDLLLK; VIPEDGPAAQNPENVKR; VIPEDGPAAQNPENVK; SKDEKILHIK; YAELLVSQGVVNQPEYEEEISK; YPNAELAWCQEEHK; FLQMCNDDPDVLPDLK; VVNAPIFHVNSDDPEAVMYVCKVAAEWR; SSFDEMLPGTHFQRVIPEDGPAAQNPENVK; VVNAPIFHVNSDDPEAVMYVCK; Comb; PMF 1 IPI00098902.3
175 S_Total95_2273 IPI00020416.6 |SWISS-PROT:P29144 |TREMBL:Q5VZU9; Q5VZV2; Q5VZU8 |REFSEQ_NP:NP_003282 |ENSEMBL:ENSP00000257342 |H-INV:HIT000022532 Tax_Id=9606 Tripeptidyl peptidase II 25 ETYPNYLPLYVAR; ETGAASFLCR; KETGAASFLCR; LDSSDIYNELK; VPITAVIAAK; ACIDSNEDGDLSK; EELQSQVELLNSFEK; GTLTEAFPVLGGK; IVDIIDTTGSGDVNTATEVEPK; ACIDSNEDGDLSKSTVLR; AYDYLVQNTSFANK; STLVDALCR; YNQPFFVTSLPDDK; ICEVINEAVWK; YEDLAPCITLK; MATAATEEPFPFHGLLPK; EEEGESPLDSLAETFWETTK; DGEIVGLSGR; IPASWTNPSGK; NGYDFYPK; YHIGIKNGYDFYPK; EGLHYTEVCGYDIASPNAGPLFR; DPVQVAAPSDHGVGIEPVFPENTENSEK; LKDLPFIVSHR; PMF 1 IPI00020416.6
176 S_Total95_2685 IPI00218696.1 |SWISS-PROT:Q05682-4 |TREMBL:Q9NYG1 |REFSEQ_NP:NP_004333 |ENSEMBL:ENSP00000354513 Tax_Id=9606 Splice Isoform 4 of Caldesmon 25 LEQYTSAIEGTK; YEIEETETVTK; EFDPTITDASLSLPSR; GNVFSSPTAAGTPNK; TTTTNTQVEGDDEAAFLER; QQEAALELEELKK; SAKPTKPAASDLPVPAEGVR; PGDVSSKRNLWEK; QKEFDPTITDASLSLPSR; QKMPEDGLSDDKK; EAEGAPQVEAGK; MPEDGLSDDK; MPEDGLSDDKKPFK; PTKPAASDLPVPAEGVR; QEEESLGQVTDQVEVNAQNSVPDEEAK; QQEAALELEELK; VLEEEEQR; GETESEEFEK; GSIGENQIKDEK; MQNDTAENETTEK; MQNDTAENETTEKEEK; RGETESEEFEK; QKQEEESLGQVTDQVEVNAQNSVPDEEAK; SPAPKPSDLRPGDVSSK; IAYQRNDDDEEEAAR 1 IPI00218696.1
177 S_Total95_2742 IPI00016827.1 |TREMBL:Q9Y2P5 |REFSEQ_NP:NP_036386 |ENSEMBL:ENSP00000263093 Tax_Id=9606 Very long-chain acyl-CoA synthetase homolog 2 25 VVSQQPFVGYR; WLPADVIFLAK; YLCNIPQQPEDR; ADVWETFQQR; AWLPAYATPHFIR; ALLVWTGPGAGSVTFGELDAR; DNQGFCIPVGLGEPGLLLTK; EGFNVGIVVDPLFVLDNR; VLVVDPDLR; AQSFRPLTAEMYQAVCEGTWR; FSTSCFWDDCR; QSGDVYYNTGDVLAMDR; SPALFIYTSGTTGLPK; VGMAAVQLAPGQTFDGEK; ACQAAWALK; QPPDTFVDAFER; ESLEEILPK; LGCPTAWINPHGR; GMPLAHSVLSSGAR; MLSPFELVQFDMEAAEPVR; PLTAEMYQAVCEGTWR; IWEVYGSTEGNMGLVNYVGR; GENVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGK; AELGDPASLCAGEPTALLVLASQAVPALCMWLGLAK; CFYLSHTSPTPGVGALGAALDAAPSHPVPADLR 1 IPI00016827.1
178 S_Total95_3371 IPI00455473.1 |TREMBL:Q5JRA6 |REFSEQ_XP:XP_496436 |ENSEMBL:ENSP00000345866 Tax_Id=9606 PREDICTED: similar to RIKEN cDNA A930039G15 gene 25 QFDVNLQVPDR; VIGDTHASEVSQKPNTEK; EQQSLQRFQK; VEEDDYPSEELLEDENAINAK; GGNDSDELANGEVGGDR; TQTAISVVEEDLK; TSGLAGEPEGELSK; ASESQILSIAEKMLDTR; GMLHEEKPGEQILEGGSESESAQK; VYQVTEQQISEK; DEPPPASQSTSQDCSQALK; EELQVPTDETDFVCFDGGR; FGSTADALVSDDETTR; MAAAPGLLVWLLVLRLPWR; SEFGSVDGPLPHPR; EQLQQEIEDWSK; EQNVKNQDLISENK; LRASVSTKCNLEDQVK; DLDPGPVTTEDTPMDAIDANK; LSQEEYER; MAMLQEEPVIVK; VEILNELYQQK; IEEMEDELQK; LVTSLEDDFDEELDTEYYAVGK; RIEEMEDELQK 1 IPI00455473.1
179 S_Total95_10 IPI00478493.1 |SWISS-PROT:P00738 |TREMBL:Q6LBY9 |REFSEQ_NP:NP_005134 |ENSEMBL:ENSP00000348170 |H-INV:HIT000012486 Tax_Id=9606 Haptoglobin precursor 24 DIAPTLTLYVGK; SCAVAEYGVYVK; QLVEIEK; VGYVSGWGR; VTSIQDWVQK; YVMLPVADQDQCIR; AVGDKLPECEAVCGK; SPVGVQPILNEHTFCAGMSK; AVGDKLPECEAVCGKPK; GSFPWQAK; NPANPVQR; LPECEAVCGK; LPECEAVCGKPK; HYEGSTVPEKKTPK; YQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDK; TEGDGVYTLNDK; LPECEADDGCPKPPEIAHGYVEHSVR; LRTEGDGVYTLNDK; TEGDGVYTLNDKK; AVGDKLPECEADDGCPKPPEIAHGYVEHSVR; AVGDKLPECEADDGCPK; TEGDGVYTLNNEK; LRTEGDGVYTLNNEK; PMF; Comb 1 IPI00478493.1
180 S_Total95_101 IPI00465032.2 |SWISS-PROT:P05165 |TREMBL:Q5VXU2; Q8WXQ7 |REFSEQ_NP:NP_000273 |ENSEMBL:ENSP00000308554 |H-INV:HIT000029377 Tax_Id=9606 Propionyl Coenzyme A carboxylase, alpha polypeptide 24 FLSDVYPDGFK; VDSGIQPGSDISIYYDPMISK; MPVIKPDIANWELSVK; SVHCQAGDTVGEGDLLVELE; VTEDTSSVLR; LSSQEAASSFGDDR; AQAVHPGYGFLSENK; LSQYQEPLHLPGVR; VVEEAPSIFLDAETR; INGWAVECR; KAEVNTIPGFDGVVK; VVEEAPSIFLDAETRR; YSSAGTVEFLVDSKK; KNFYFLEMNTR; IAWDDEETR; AMGEQAVALAR; MADEAVCVGPAPTSK; YSSAGTVEFLVDSK; SYLNMDAIMEAIK; VYAEDPYK; TVAIHSDVDASSVHVK; LQVEHPVTECITGLDLVQEMIR; IAWDDEETRDGFR; Comb; PMF 1 IPI00465032.2
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home