Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
211 S_Total95_6074 IPI00026089.3 |SWISS-PROT:O75533 |TREMBL:Q9NTB4; Q7Z497 |REFSEQ_NP:NP_036565 |ENSEMBL:ENSP00000335321 |H-INV:HIT000014291; HIT000025698 Tax_Id=9606 Splicing factor 3B subunit 1 23 AFAVVASALGIPSLLPFLK; GGDSIGETPTPGASK; AIGPHDVLATLLNNLK; ILVVIEPLLIDEDYYAR; IVQQIAILMGCAILPHLR; SLSFLFEYIGEMGK; QQLAEKAKAGELK; WDQTADQTPGATPK; AALDEAQGVGLDSTGYYDQEIYGGSDSR; DYIYAVTPLLEDALMDR; IMGNLGAADIDHK; IWDPTPSHTPAGAATPGR; LLVDVDESTLSPEEQK; QCCGTDGVEANYIK; VVNGAAASQPPSK; FAGYVTSIAATELEDDDDDYSSSTSLLGQK; ICFELLELLK; IVDDLKDEAEQYR; NRPLSDEELDAMFPEGYK; QLVDTTVELANK; WDETPASQMGGSTPVLTPGK; AIVNVIGMHKMTPPIKDLLPR; VVKQCCGTDGVEANYIKTEILPPFFK 1 IPI00026089.3
212 S_Total95_21 IPI00220669.1 |SWISS-PROT:P34896-3 |TREMBL:Q9UMC9; Q9UMC8 |ENSEMBL:ENSP00000345881 Tax_Id=9606 Splice Isoform 3 of Serine hydroxymethyltransferase, cytosolic 22 EEVESFASLFPLPGLPDF; AVLEALGSCLNNK; DSDVEVYNIIK; LIIAGTSCYSR; VLEACSIACNK; ISATSIFFESMPYK; GIELTLQIQSDTGVR; VNPDTGYINYDQLEENAR; YQAAVQALR; YSEGYPGKR; YYGGTEFIDELETLCQK; DADLWSSHDK; KISATSIFFESMPYK; MLAQPLKDSDVEVYNIIK; VGLELIASENFASR; LAGDKYQAAVQALR; LGTPALTSR; IMGLDLPDGGHLTHGFMTDK; LDPQCWGVNVQPYSGSPANFAVYTALVEPHGR; GGSDNHLILVDLR; YSEGYPGQR; PMF; Comb 1 IPI00220669.1
213 S_Total95_261 IPI00401990.1 |TREMBL:Q53FJ7; Q53GZ9 |REFSEQ_NP:NP_057318 |ENSEMBL:ENSP00000348429 |H-INV:HIT000002814 Tax_Id=9606 Acyl-CoA synthetAse long-chAin fAmily member 5 isoform A 22 LAQGEYIAPEK; VGFFQGDIR; EAILEDLQK; GLAVSDNGPCLGYR; AIFLHPEPFSIENGLLTPTLK; SGIEILSLYDAENLGK; SQPVLQIFVHGESLR; SSLVGVVVPDTDVLPSFAAK; TQEALDSDGWLHTGDIGR; TQIDSLYEHIQD; ALVLIGNVEK; GSFEELCQNQVVR; IVQAVVYSCGARVGFFQGDIR; GAMITHQNIVSNAAAFLK; NNDLTSCCFSDAK; IVQAVVYSCGAR; TLKPTLFPAVPR; VIILMDPFDDDLK; KPVPPSPEDLSVICFTSGTTGDPK; ELQKGIIR; AEYLGSCLLHK; Comb; PMF 2 IPI00008037.1, IPI00401990.1
214 S_Total95_273 IPI00029733.1 |SWISS-PROT:Q04828 |TREMBL:Q5SR15 |REFSEQ_NP:NP_001344 |ENSEMBL:ENSP00000324589 |H-INV:HIT000038757; HIT000037139 Tax_Id=9606 Aldo-keto reductase family 1 member C1 22 SIGVSNFNR; REDIFYTSK; TPALIALR; EDIFYTSK; EEPWVDPNSPVLLEDPVLCALAK; ILFDTVDLCATWEAVEK; DIVLVAYSALGSHR; QLEMILNKPGLK; RTPALIALR; SKDIVLVAYSALGSHR; YKPVCNQVECHPYFNQR; LWCNSHRPELVR; NLQLDYVDLYLIHFPVSVK; NLQLDYVDLYLIHFPVSVKPGEEVIPK; LWCNSHRPELVRPALER; RQLEMILNKPGLK; LNDGHFMPVLGFGTYAPAEVPK; YLTLDIFAGPPNYPFSDEY; LAIEAGFR; QNVQVFEFQLTSEEMK; HIDSAHLYNNEEQVGLAIR; Comb; PMF 1 IPI00029733.1
215 S_Total95_441 IPI00027223.2 |SWISS-PROT:O75874 |TREMBL:Q6FI37; Q6FHQ6; Q567U4; Q7Z3V0 |REFSEQ_NP:NP_005887 |ENSEMBL:ENSP00000260985 |H-INV:HIT000035992 Tax_Id=9606 Isocitrate dehydrogenase [NADP] cytoplasmic 22 DIFQEIYDK; FKDIFQEIYDK; ATDFVVPGPGK; SDYLNTFEFMDK; TVEAEAAHGTVTR; VEITYTPSDGTQK; NILGGTVFR; DLAACIK; SEGGFIWACK; LIDDMVAQAMK; GQETSTNPIASIFAWTR; SIEDFAHSSFQMALSK; IIWELIK; ISGGSVVEMQGDEMTR; GWPLYLSTK; VTYLVHNFEEGGGVAMGMYNQDK; SIEDFAHSSFQMALSKGWPLYLSTKNTILK; KISGGSVVEMQGDEMTR; LVSGWVKPIIIGR; LIFPYVELDLHSYDLGIENR; HAYGDQYR; Comb; PMF 1 IPI00027223.2
216 S_Total95_571 IPI00298497.3 |SWISS-PROT:P02675 |REFSEQ_NP:NP_005132 |ENSEMBL:ENSP00000306099 Tax_Id=9606 Fibrinogen beta chain precursor 22 AHYGGFTVQNEANK; YQISVNK; DNENVVNEYSSELEK; HQLYIDETVNSNIPTNLR; NYCGLPGEYWLGNDK; TPCTVSCNIPVVSGK; DNDGWLTSDPR; EDGGGWWYNR; KGGETSEMYLIQPDSSVKPYR; QGFGNVATNTDGK; VYCDMNTENGGWTVIQNR; LESDVSAQMEYCR; EEAPSLRPAPPPISGGGYR; MGPTELLIEMEDWK; YYWGGQYTWDMAK; GGETSEMYLIQPDSSVK; HGTDDGVVWMNWK; KGGETSEMYLIQPDSSVK; REEAPSLRPAPPPISGGGYR; APDAGGCLHADPDLGVLCPTGCQLQEALLQQER; KAPDAGGCLHADPDLGVLCPTGCQLQEALLQQER; PMF; Comb 1 IPI00298497.3
217 S_Total95_609 IPI00024993.4 |SWISS-PROT:P30084 |REFSEQ_NP:NP_004083 |ENSEMBL:ENSP00000248508 |H-INV:HIT000034068 Tax_Id=9606 Enoyl-CoA hydratase, mitochondrial precursor 22 AFAAGADIK; ICPVETLVEEAIQCAEK; LFYSTFATDDR; NNTVGLIQLNRPK; LFYSTFATDDRK; ALNALCDGLIDELNQALK; AQFAQPEILIGTIPGAGGTQR; KLFYSTFATDDR; KLFYSTFATDDRK; GKNNTVGLIQLNRPK; HWDHLTQVK; NNTVGLIQLNR; ESVNAAFEMTLTEGSK; EMQNLSFQDCYSSK; EGMTAFVEK; SLAMEMVLTGDR; QAGLVSKICPVETLVEEAIQCAEK; KPVIAAVNGYAFGGGCELAMMCDIIYAGEK; SLAMEMVLTGDRISAQDAKQAGLVSK; ESVNAAFEMTLTEGSKLEK; EGMTAFVEKR; PMF; Comb 1 IPI00024993.4
218 S_Total95_683 IPI00009367.1 |SWISS-PROT:P21549 |TREMBL:Q53QU6; Q9BXA1 |REFSEQ_NP:NP_000021 |ENSEMBL:ENSP00000302620 Tax_Id=9606 Serine--pyruvate aminotransferase 22 ALNAPPGTSLISFSDK; EGIQYVFQTR; LQALGLQLFVK; QGIDILYSGSQK; DMYQIMDEIK; LPTVTTVAVPAGYDWR; ESLALIAEQGLENSWR; IGLLGCNATR; LQALGLQLFVKDPALR; WLANFWGCDDQPR; ALLKPLSIPNQLLLGPGPSNLPPR; CLLLVDSVASLGGTPLYMDR; DIVSYVIDHFDIEIMGGLGPSTGK; MYHHTIPVISLYSLR; TKPFSFYLDIK; IMAAGGLQMIGSMSK; EAAAYLHGR; PLSIPNQLLLGPGPSNLPPR; DPGGHYTLQEVEEGLAQHK; PVLLFLTHGESSTGVLQPLDGFGELCHR; NPLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQR; PMF; Comb 1 IPI00009367.1
219 S_Total95_705 IPI00011200.4 |SWISS-PROT:O43175 |TREMBL:Q96RV8; Q5SZU3; Q9UMY3; Q8N5M8; Q96RV9; Q96RV6; Q96RV7; Q9UMY2; Q5SZU1; Q96RV5 |REFSEQ_NP:NP_006614 |ENSEMBL:ENSP00000263167 |H-INV:HIT000018173; HIT000030335; HIT000035203; HIT000029500 Tax_Id=9606 D-3-phosphoglycerate dehydrogenase 22 AGTGVDNVDLEAATR; DLPLLLFR; GGIVDEGALLR; GTIQVITQGTSLK; ILQDGGLQVVEK; VTADVINAAEK; NAGNCLSPAVIVGLLK; TLGILGLGR; TQTSDPAMLPTMIGLLAEAGVR; EELIAELQDCEGLIVR; KILQDGGLQVVEK; ALVDHENVISCPHLGASTK; PWIGLAEALGTLMR; VLISDSLDPCCR; ALQSGQCAGAALDVFTEEPPR; QADVNLVNAK; CGEEIAVQFVDMVK; RDLPLLLFR; ALQSGQCAGAALDVFTEEPPRDR; KGILVMNTPNGNSLSAAELTCGMIMCLAR; LLSYQTSLVSDGETWHVMGISSLLPSLEAWK; PMF; Comb 1 IPI00011200.4
220 S_Total95_841 IPI00037448.3 |SWISS-PROT:Q9UBQ7 |TREMBL:Q5T944 |REFSEQ_NP:NP_036335 |ENSEMBL:ENSP00000313432 |H-INV:HIT000029768; HIT000009252 Tax_Id=9606 Glyoxylate reductase/hydroxypyruvate reductase 22 GDVVNQDDLYQALASGK; ILDAAGANLK; LPEAIEEVK; ETAVFINISR; IAAAGLDVTSPEPLPTNHPLLTLK; RLPEAIEEVK; VISTMSVGIDHLALDEIK; NTMSLLAANNLLAGLR; VGYTPDVLTDTTAELAVSLLLTTCR; MKETAVFINISR; NCVILPHIGSATHR; NTMSLLAANNLLAGLRGEPMPSELKL; PLWLCGYGLTQSTVGIIGLGR; GEPMPSELKL; GVAGAHGLLCLLSDHVDK; LPEAIEEVKNGGWTSWK; GVAGAHGLLCLLSDHVDKR; NGGWTSWKPLWLCGYGLTQSTVGIIGLGR; ILDAAGANLKVISTMSVGIDHLALDEIK; AADCEVEQWDSDEPIPAK; AADCEVEQWDSDEPIPAKELER; PMF; Comb 1 IPI00037448.3
221 S_Total95_1070 IPI00024787.1 |SWISS-PROT:O14975 |TREMBL:Q53FY6; Q53GS2 |REFSEQ_NP:NP_003636 |ENSEMBL:ENSP00000267842 Tax_Id=9606 Very-long-chain acyl-CoA synthetase 22 DALYFLDDTAK; DETLTYAQVDR; VLLVSPELQAAVEEILPSLK; FSASQFWDDCR; ITQLTPFNGYAGAK; KDDVSIYYVSR; YDVEKDEPVRDENGYCVR; SLLHCFQCCGAK; TSNTDGIDSFLDK; VDEVSTEPIPESWR; DETLTYAQVDRR; GEVGLLVCK; LFQHIADYLPSYAR; MTLVEEGFNPAVIK; MYVPMTEDIYNAISAK; YNVTVIQYIGELLR; KYNVTVIQYIGELLR; YLCNSPQKPNDR; TSNTDGIDSFLDKVDEVSTEPIPESWR; IWYGTGLTFVSGLK; SEVTFSTPALYIYTSGTTGLPK; Comb 1 IPI00024787.1
222 S_Total95_1075 IPI00554469.1 |SWISS-PROT:Q16891-2 Tax_Id=9606 Splice Isoform 2 of Mitochondrial inner membrane protein 22 VVSQYHELVVQAR; ANCSDNEFTQALTAAIPPESLTR; GIEQAVQSHAVAEEEAR; KAVDEAADALLK; TSSAETPTIPLGSAVEAIK; LSEQELQFR; AVDEAADALLK; ELDSITPEVLPGWK; SEFEQNLSEK; RKAVDEAADALLK; LSQEQVDNFTLDINTAYAR; IAGAGLLFVGGGIGGTILYAK; LFEMVLGPAAYNVPLPK; GVYSEETLR; YSTSGSSGLTTGK; GDTPASATAGDTLSVPAPAVQPEESLK; LHNMIVDLDNVVK; ERPPEEVAARLAQQEK; TDHPEIGEGKPTPALSEEASSSSIR; QKGDTPASATAGDTLSVPAPAVQPEESLK; QTASVTLQAIAAQNAAVQAVNAHSNILK; Comb; PMF 1 IPI00554469.1
223 S_Total95_1597 IPI00477225.1 |SWISS-PROT:P13797 |TREMBL:Q5JRN9; Q96HI1 |ENSEMBL:ENSP00000348163 Tax_Id=9606 T-plastin 22 KIENCNYAVELGK; IENCNYAVELGK; YAFVNWINK; LSPEELLLR; MINLSVPDTIDER; IGLFADIELSR; AYFHLLNQIAPK; ISFDEFVYIFQEVK; ANDDIIVNWVNR; LNLAFVANLFNK; NEALAALLR; YTLNVLEDLGDGQK; DELDELKEAFAK; VYALPEDLVEVKPK; YPALTKPENQDIDWTLLEGETR; QFVTPADVVSGNPK; EGICALGGTSELSSEGTQHSYSEEEK; TISSSLAVVDLIDAIQPGCINYDLVK; DGETLEELMK; HVIPMNPNTDDLFK; FSLVGIGGQDLNDGNQTLTLALVWQLMRR; Comb 1 IPI00477225.1
224 S_Total95_2383 IPI00244391.2 |SWISS-PROT:P47989 |TREMBL:Q585T6; Q9UH91 |REFSEQ_NP:NP_000370 |ENSEMBL:ENSP00000289041 Tax_Id=9606 Xanthine dehydrogenase/oxidase 22 TNLPSNTAFR; EGEYFSAFK; IPAFGSIPIEFR; ITYEELPAIITIEDAIK; STVVSTAVALAAYK; CWEECLASSQYHAR; DPPADVQLFQEVPK; LDPTFASATLLFQK; NADPETTLLAYLR; NNSFYGPELK; YENELSLR; LGQENLEDK; TLLSPEEILLSIEIPYSR; DGGCCGGDGNNPNCCMNQK; VTWIQASTLK; DEDMLITGGR; LEGFTLPR; LGCGEGGCGACTVMLSK; NQPEPTMEEIENAFQGNLCR; TVQMDHTFFPGYR; DHSVSLSPSLFKPEEFTPLDPTQEPIFPPELLR; DKVTCVGHIIGAVVADTPEHTQR 1 IPI00244391.2
225 S_Total95_2494 IPI00299568.1 |SWISS-PROT:P11509 |TREMBL:Q13120 |REFSEQ_NP:NP_000753 |ENSEMBL:ENSP00000301141 Tax_Id=9606 Cytochrome P450 2A6 22 DFIDSFLIR; EALVDQAEEFSGR; SDAFVPFSIGK; YGPVFTIHLGPR; KSDAFVPFSIGK; RFSIATLR; TVSNVISSIVFGDR; HVGFATIPR; NPNTEFYLK; NYTMSFLPR; DFIDSFLIRMQEEEK; LPPGPTPLPFIGNYLQLNTEQMYNSLMK; HLPGPQQQAFKLLQGLEDFIAK; NCFGEGLAR; MPYMEAVIHEIQR; GEQATFDWVFK; VVVLCGHDAVR; RVVVLCGHDAVR; GTGGANIDPTFFLSR; DKEFLSLLR; DPSFFSNPQDFNPQHFLNEK; TVSNVISSIVFGDRFDYK 1 IPI00299568.1
226 S_Total95_2693 IPI00384489.1 |TREMBL:Q86X54 |ENSEMBL:ENSP00000319361 Tax_Id=9606 AP1B1 protein 22 LSHANSAVVLSAVK; DCPLNAEAASSK; APEVSQHVYQAYETILK; DIPNENEAQFQIR; LAPPLVTLLSAEPELQYVALR; LASQANIAQVLAELK; NINLIVQK; VNYVVQEAIVVIK; YESVIATLCENLDSLDEPEAR; GEIFELKAELNSDK; KLAPPLVTLLSAEPELQYVALR; DCEDPNPLIR; DLDYYGTLLK; EYATEVDVDFVR; NVEGQDMLYQSLK; ITEYLCEPLR; DVSALFPDVVNCMQTDNLELK; MEPLNNLQVAVK; IDNADELLESFLEGFHDESTQVQLQLLTAIVK; NSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMK; KPTETQELVQQVLSLATQDSDNPDLR; IQPGNPSCTLSLK 1 IPI00384489.1
227 S_Total95_2695 IPI00328257.4 |SWISS-PROT:Q10567-1 |REFSEQ_NP:NP_001118 |ENSEMBL:ENSP00000350199 Tax_Id=9606 Splice Isoform A of Adapter-related protein complex 1 beta 1 subunit 22 LSHANSAVVLSAVK; DCPLNAEAASSK; APEVSQHVYQAYETILK; DIPNENEAQFQIR; LAPPLVTLLSAEPELQYVALR; LASQANIAQVLAELK; NINLIVQK; VNYVVQEAIVVIK; YESVIATLCENLDSLDEPEAR; GEIFELKAELNSDK; KLAPPLVTLLSAEPELQYVALR; DCEDPNPLIR; DLDYYGTLLK; EYATEVDVDFVR; NVEGQDMLYQSLK; ITEYLCEPLR; QVGSISMDLQLTNK; DVSALFPDVVNCMQTDNLELK; MEPLNNLQVAVK; IDNADELLESFLEGFHDESTQVQLQLLTAIVK; NSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMK; KPTETQELVQQVLSLATQDSDNPDLR 2 IPI00413947.1, IPI00328257.4
228 S_Total95_3353 IPI00064591.1 |SWISS-PROT:Q9BX66-8 Tax_Id=9606 Splice Isoform 8 of Sorbin and SH3 domain-containing protein 1 22 DGDIVDVMEK; LTPVQVLEYGEAIAK; QGIFPITYVDVIK; SVLEGGDIPLQGLSGLK; FDFKAQTLKELPLQK; SATASPQQPQAQQR; TYIELLPPAEK; LSSSADANGNAQPSSLAAK; DDDSDLYSPR; SSSLKSSSERNDWEPPDK; CDDGWFVGTSR; NPVDYMDLPFSSSPSR; SQDSSPLLNEVSSSLIGTDSQAFPSVSK; STQDLSDVSMDEVGIPLR; ESDGAPGDLTSLENER; HFIPADYLESTEEFIR; LSSLSDPVSER; VGEQDSAPTQEKPTSPGK; RVGEQDSAPTQEKPTSPGK; SVHPNLPSDK; FGDLLNIDDTAK; EQEEADIAAR 3 IPI00514576.1, IPI00064591.1, IPI00002491.3
229 S_Total95_3967 IPI00006482.1 |SWISS-PROT:P05023-1 |TREMBL:Q58I23; Q5TC05 |REFSEQ_NP:NP_000692 |ENSEMBL:ENSP00000295598 |H-INV:HIT000031408 Tax_Id=9606 Splice Isoform Long of Sodium/potassium-transporting ATPase alpha-1 chain precursor 22 LNIPVSQVNPR; NLEAVETLGSTSTICSDK; QGAIVAVTGDGVNDSPALKK; GVGIISEGNETVEDIAAR; QGAIVAVTGDGVNDSPALK; VDNSSLTGESEPQTR; LIIVEGCQR; VIMVTGDHPITAK; LSLDELHR; SPDFTNENPLETR; DGPNALTPPPTTPEWIK; NIAFFSTNCVEGTAR; AVAGDASESALLK; AVFQANQENLPILK; IVEIPFNSTNK; CIELCCGSVK; DAFQNAYLELGGLGER; YEPAAVSEQGDK; YEPAAVSEQGDKK; DKYEPAAVSEQGDK; MSINAEEVVVGDLVEVK; DMTSEQLDDILK 1 IPI00006482.1
230 S_Total95_5841 IPI00396171.3 |SWISS-PROT:P27816-1 |TREMBL:Q59FT2 |REFSEQ_NP:NP_002366 |ENSEMBL:ENSP00000353375 Tax_Id=9606 Splice Isoform 1 of Microtubule-associated protein 4 22 TDYIPLLDVDEK; DGVLTLANNVTPAK; DVPPLSETEATPVPIK; NVVLPTETEVAPAK; DMAQLPETEIAPAK; DMELPTEKEVALVK; DMQPSMESDMALVK; DMSPLSETEMALGK; KKPCSETSQIEDTPSSK; KPCSETSQIEDTPSSK; NVCLPPEMEVALTEDQVPALK; TTDMAPSKETEMALAK; VALSSETEVALAR; DFIATLEAEAFDDVVGETVGK; WPTETDVSSAK; MYHDDDLADLVFPSSATADTSIFAGQNDPLK; TTTLSGTAPAAGVVPSR; EAQTLDSQIQETSI; TTTAAAVASTGPSSR; VGSLDNVGHLPAGGAVK; KPCNSQPSELSSETSGIAR; PEEGRPVVSGTGNDITTPPNK 1 IPI00396171.3
231 S_Total95_68-1 IPI00021891.5 |SWISS-PROT:P02679-1 |REFSEQ_NP:NP_068656 |ENSEMBL:ENSP00000336829 Tax_Id=9606 Splice Isoform Gamma-B of Fibrinogen gamma chain precursor 21 LTIGEGQQHHLGGAK; YEASILTHDSSIR; YLQEIYNSNNQK; VELEDWNGR; DTVQIHDITGK; AIQLTYNPDESSKPNMIDAATLK; EGFGHLSPTGTTEFWLGNEK; IHLISTQSAIPYALR; LTYAYFAGGDAGDAFDGFDFGDDPSDK; QSGLYFIKPLK; VAQLEAQCQEPCK; ASTPNGYDNGIIWATWK; RLDGSVDFKK; VAQLEAQCQEPCKDTVQIHDITGK; ANQQFLVYCEIDGSGNGWTVFQK; FEGNCAEQDGSGWWMNK; CHAGHLNGVYYQGGTYSK; VAQLEAQCQEPCKDTVQIHDITGKDCQDIANK; DNCCILDER; FGSYCPTTCGIADFLSTYQTK; PMF; Comb 1 IPI00021891.5
232 S_Total95_68-2 IPI00219713.1 |SWISS-PROT:P02679-2 |TREMBL:Q53Y18 |REFSEQ_NP:NP_000500 |ENSEMBL:ENSP00000306631 |H-INV:HIT000033006; HIT000039241 Tax_Id=9606 Splice Isoform Gamma-A of Fibrinogen gamma chain precursor 21 LTIGEGQQHHLGGAK; YEASILTHDSSIR; YLQEIYNSNNQK; VELEDWNGR; DTVQIHDITGK; AIQLTYNPDESSKPNMIDAATLK; EGFGHLSPTGTTEFWLGNEK; IHLISTQSAIPYALR; LTYAYFAGGDAGDAFDGFDFGDDPSDK; QSGLYFIKPLK; VAQLEAQCQEPCK; ASTPNGYDNGIIWATWK; RLDGSVDFKK; VAQLEAQCQEPCKDTVQIHDITGK; ANQQFLVYCEIDGSGNGWTVFQK; FEGNCAEQDGSGWWMNK; CHAGHLNGVYYQGGTYSK; VAQLEAQCQEPCKDTVQIHDITGKDCQDIANK; DNCCILDER; FGSYCPTTCGIADFLSTYQTK; PMF; Comb 1 IPI00219713.1
233 S_Total95_74 IPI00220271.2 |SWISS-PROT:P14550 |TREMBL:Q6IAZ4; Q5T621 |REFSEQ_NP:NP_006057; NP_697021 |ENSEMBL:ENSP00000312606; ENSP00000262749 |H-INV:HIT000032437; HIT000029823 Tax_Id=9606 Alcohol dehydrogenase 21 GLVQALGLSNFNSR; DAGHPLYPFNDPY; GLEVTAYSPLGSSDR; HHPEDVEPALR; YIVPMLTVDGK; EELFVTSK; MPILGLGTWK; AWRDPDEPVLLEEPVVLALAEK; DPDEPVLLEEPVVLALAEK; SPAQILIR; HIDCAAIYGNEPEIGEALKEDVGPGK; NADGTICYDSTHYK; QIDDILSVASVR; VFDFTFSPEEMK; YALSVGYR; AVPREELFVTSK; HIDCAAIYGNEPEIGEALK; ALEALVAK; KVICIPK; PAVLQVECHPYLAQNELIAHCQAR; PMF; Comb 1 IPI00220271.2
234 S_Total95_440 IPI00295777.4 |SWISS-PROT:P21695 |TREMBL:Q8N1B0 |REFSEQ_NP:NP_005267 |ENSEMBL:ENSP00000301149 |H-INV:HIT000041457 Tax_Id=9606 Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic 21 ELYSILQHK; LTEIINTQHENVK; LGLMEMIAFAK; LISEVIGER; DPAQGQLLK; IVGGNAAQLAQFDPR; KLTEIINTQHENVK; NVVAVGAGFCDGLGFGDNTK; GLVDKFPLFMAVYK; ITVVQEVDTVEICGALK; KVCIVGSGNWGSAIAK; ELLNGQKLQGPETAR; VCIVGSGNWGSAIAK; FCETTIGCK; FCETTIGCKDPAQGQLLK; FPLFMAVYK; LGIPMSVLMGANIASEVADEK; VTMWVFEEDIGGK; LPPNVVAVPDVVQAAEDADILIFVVPHQFIGK; LFCSGPVSSATFLESCGVADLITTCYGGR; PMF; Comb 1 IPI00295777.4
235 S_Total95_466 IPI00024623.3 |SWISS-PROT:P45954 |TREMBL:Q5SQN6 |REFSEQ_NP:NP_001600 |ENSEMBL:ENSP00000346877 |H-INV:HIT000036351; HIT000026733 Tax_Id=9606 Acyl-CoA dehydrogenase, short/branched chain specific, mitochondrial precursor 21 ADKEGDYYVLNGSK; ASSTCPLTFENVK; ATYLPQLTTEK; DTPGLHIGKPENK; LLEAGKPFIK; YAIGSLNEGR; YYASEIAGQTTSK; CIEWMGGVGYTK; LFDFQGLQHQVAHVATQLEAAR; VDASVAVFCEIQNTLINTLIR; VGSFCLSEAGAGSDSFALK; FAQEQIAPLVSTMDENSK; GITSFLVDR; IGIAAQMLGLAQGCFDYTIPYIK; IGTIYEGASNIQLNTIAK; VPEANILGQIGHGYK; EGDYYVLNGSK; KFAQEQIAPLVSTMDENSK; ASSTCPLTFENVKVPEANILGQIGHGYK; SSQSEALLNITNNGIHFAPLQTFTDEEMMIK; PMF; Comb 1 IPI00024623.3
236 S_Total95_737 IPI00219365.2 |SWISS-PROT:P26038 |TREMBL:Q6PJT4 |REFSEQ_NP:NP_002435 |ENSEMBL:ENSP00000275995 |H-INV:HIT000037926 Tax_Id=9606 Moesin 21 EDAVLEYLK; AQMVQEDLEK; FYPEDVSEELIQDITQR; APDFVFYAPR; IGFPWSEIR; ALTSELANAR; EGILNDDIYCPPETAVLLASYAVQSK; ESEAVEWQQK; TQEQLALEMAELTAR; AQKELEEQTR; AQMVQEDLEKTRAELK; GSELWLGVDALGLNIYEQNDR; KTQEQLALEMAELTAR; TANDMIHAENMR; EVWFFGLQYQDTK; IQVWHEEHR; KPDTIEVQQMK; LFFLQVK; RKPDTIEVQQMK; TAMSTPHVAEPAENEQDEQDENGAEASADLR; PMF; Comb 2 IPI00514912.1, IPI00219365.2
237 S_Total95_763 IPI00171391.1 |TREMBL:Q9H2A2 |REFSEQ_NP:NP_072090 |ENSEMBL:ENSP00000265605 Tax_Id=9606 Aldehyde dehydrogenase 12 21 DSYDFFTEIK; VPNSGKDEIEAAVK; IAPAMAAGNTVIAK; ELNLPFGGMK; APVGVAGLISPWNLPLYLLTWK; VLNQVADLLEQSLEEFAQAESK; AGVPPGVVNIVFGTGPR; NPAIIFEDANLDECIPATVR; VGEALVSHPEVPLISFTGSQPTAER; ALAEGAQIWCGEGVDK; FLPCSSYIDSYDPSTGEVYCR; YGLAATVWSSNVGR; MAGTNALLMLENFIDGK; LQSGLVWTNCWLIR; NQAGYFMLPTVITDIK; ITQLSAPHCK; IAPAMAAGNTVIAKPSELTSVTAWMLCK; VGIPSDPLVSIGALISK; KLSLELGGK; SSFANQGEICLCTSR; Comb; PMF 1 IPI00171391.1
238 S_Total95_819 IPI00604664.1 |TREMBL:Q9P1A0; Q53TR8 |REFSEQ_NP:NP_004997 |ENSEMBL:ENSP00000233190 |H-INV:HIT000023225; HIT000041164; HIT000039501; HIT000035633 Tax_Id=9606 NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor 21 AVTEGAQAVEEPSIC; NDGAAILAAVSSIAQK; VLFLLGADGGCITR; FEAPLFNAR; ILQDIASGSHPFSQVLK; LEEVSPNLVR; NRLEEVSPNLVR; YDDIEGANYFQQANELSK; DVAAIAGGLVDAEALVALK; LVNQQLLADPLVPPQLTIK; VDSDTLCTEEVFPTAGAGTDLR; ALSEIAGMTLPYDTLDQVR; FASEIAGVDDLGTTGR; IASQVAALDLGYKPGVEAIR; KPMVVLGSSALQR; SATYVNTEGR; GLLTYTSWEDALSR; VAGMLQSFQGK; SNYLLNTTIAGVEEADVVLLVGTNPR; VALIGSPVDLTYTYDHLGDSPK; PMF; Comb 1 IPI00604664.1
239 S_Total95_969 IPI00217963.2 |SWISS-PROT:P08779 |TREMBL:Q16195 |REFSEQ_NP:NP_005548 |ENSEMBL:ENSP00000301653 Tax_Id=9606 Keratin, type I cytoskeletal 16 21 LAADDFR; ALEEANADLEVK; LASYLDK; LEQEIATYR; VLDELTLAR; TRLEQEIATYR; LASYLDKVR; ASLENSLEETK; ISSVLAGGSCR; GSCGIGGGIGGGSSR; VTMQNLNDR; IIAATIENAQPILQIDNAR; DAETWFLSK; APSTYGGGLSVSSR; QTVEADVNGLR; EQSSSSFSQGQSS; EVASNSELVQSSR; TEELNKEVASNSELVQSSR; EVFTSSSSSSSR; LLEGEDAHLSSQQASGQSYSSR; PMF; Comb 1 IPI00217963.2
240 S_Total95_1059 IPI00292771.3 |SWISS-PROT:Q14980-1 |ENSEMBL:ENSP00000352675 Tax_Id=9606 Splice Isoform 1 of Nuclear mitotic apparatus protein 1 21 VEFATLQEALAHALTEK; QQLSSLITDLQSSISNLSQAK; AVQAQGGESQQEAQR; DSAQTSVTQAQR; GEVLGDVLQLETLK; LQAQLNELQAQLSQK; QEAATLAANNTQLQAR; TQPDGTSVPGEPASPISQR; ALSKASPNTR; AALMESQGQQQEER; EVARLETLVR; LADDLSTLQEK; LEILQQQLQVANEAR; NSLISSLEEEVSILNR; QLADERSNR; DSALETLQGQLEEK; EAEQMGNELER; LQQLGEAHQAETEVLR; EFASHLQQLQDALNELTEEHSK; LTAQVASLTSELTTLNATIQQQDQELAGLK; PMF; Comb 2 IPI00006196.2, IPI00292771.3
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home