Liverbase v1.0
LiverbasePROTEOMESKY-LIVERHu1.0
 Database for liver-related genes , proteins and diseases
Back Home Proteome Transcriptiome KEGG |
LDGP
Liver GO slim
SerialNo Group_seria RepProAc Description Unique Peptides PepSeq GroSize ProGoup
241 S_Total95_1487 IPI00025874.1 |SWISS-PROT:P04843 |TREMBL:Q6IBR0; Q53EP4; Q96HX3; Q68DT1 |REFSEQ_NP:NP_002941 |ENSEMBL:ENSP00000296255 |H-INV:HIT000035067 Tax_Id=9606 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit precursor 21 DVPAYSQDTFK; TILPAAAQDVYYR; SEDLLDYGPFR; ALTSEIALLQSR; NIEIDSPYEISR; ATSFLLALEPELEAR; FVDHVFDEQVIDSLTVK; VTAEVVLAHLGGGSTSR; LAHLGVQVK; VACITEQVLTLVNK; ALTSEIALLQSRLK; GEDEEENNLEVR; APDELHYTYLDTFGR; FPLFGGWK; QFVVFEGNHYFYSPYPTK; TVDLSSHLAK; APDELHYTYLDTFGRPVIVAYK; ISVIVETVYTHVLHPYPTQITQSEK; THYIVGYNLPSYEYLYNLGDQYALK; NLVEQHIQDIVVHYTFNK; Comb 1 IPI00025874.1
242 S_Total95_1551 IPI00215760.2 |SWISS-PROT:P49326 |TREMBL:Q53H53; Q9HA79; Q8IV22 |REFSEQ_NP:NP_001452 |ENSEMBL:ENSP00000254090 |H-INV:HIT000005446 Tax_Id=9606 Dimethylaniline monooxygenase [N-oxide-forming] 5 21 IAVIGGGVSGLSSIK; FQENPEEGR; ALSQHPTLNDDLPNR; VGDYGYPADVLFSSR; CCVEEGLEPVCFER; EFTETAAIFEDGSR; KAILTTDDRIR; LTHFIWK; QPDFATSGQWEVVTESEGK; TDDIGGLWR; DYKNPEGFTGK; LALHLLLGPCTPIHYR; RGAWILNR; TLPSQSEMMAEISK; PTLAIIGLIQPLGAIMPISELQGR; VIIIGIGNSGGDLAVEISQTAK; TDDIGGLWRFQENPEEGR; FDHEMFGLKPK; KQPDFATSGQWEVVTESEGKK; VFPPNLERPTLAIIGLIQPLGAIMPISELQGR; Comb 1 IPI00215760.2
243 S_Total95_1576 IPI00007219.1 |SWISS-PROT:P11712 |TREMBL:Q9UQ59; Q8WW80; Q9UEH3; Q5VX92; Q5EDC5; Q6IRV8 |REFSEQ_NP:NP_000762 |ENSEMBL:ENSP00000260682 Tax_Id=9606 Cytochrome P450 2C9 21 EALIDLGEEFSGR; YALLLLLK; GFGIVFSNGK; CLVEELRK; RFDYKDQQFLNLMEK; DQQFLNLMEK; ICVGEALAGMELFLFLTSILQNFNLK; LPPGPTPLPVIGNILQIGIK; GKLPPGPTPLPVIGNILQIGIK; GTTILISLTSVLHDNK; YIDLLPTSLPHAVTCDIK; HNQPSEFTIESLENTAVDLFGAGTETTSTTLR; EFPNPEMFDPHHFLDEGGNFK; EHQESMDMNNPQDFIDCFLMK; SHMPYTDAVVHEVQR; ASPCDPTFILGCAPCNVICSIIFHK; EKHNQPSEFTIESLENTAVDLFGAGTETTSTTLR; ILSSPWIQICNNFSPIIDYFPGTHNK; YIDLLPTSLPHAVTCDIKFRNYLIPK; GIFPLAER; Comb; PMF 1 IPI00007219.1
244 S_Total95_2632 IPI00556564.1 |TREMBL:Q86SK3; Q6GRK0; Q7Z448 |REFSEQ_NP:NP_059488 |ENSEMBL:ENSP00000337915 Tax_Id=9606 Cytochrome P450, subfamily IIIA, polypeptide 4 21 ECYSVFTNR; ETQIPLK; NKDNIDPYIYTPFGSGPR; DNIDPYIYTPFGSGPR; EMVPIIAQYGDVLVR; SLLSPTFTSGK; VDFLQLMIDSQNSK; DVEINGMFIPK; RPFGPVGFMK; VLQNFSFKPCK; LQEEIDAVLPNK; LSLGGLLQPEKPVVLK; GVVVMIPSYALHR; LSLGGLLQPEK; ALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQK; APPTYDTVLQMEYLDMVVNETLR; LGIPGPTPLPFLGNILSYHK; SAISIAEDEEWKR; VWGFYDGQQPVLAITDPDMIK; SAISIAEDEEWK; GFCMFDMECHK 1 IPI00556564.1
245 S_Total95_2635 IPI00465138.2 |SWISS-PROT:P08684 Tax_Id=9606 Cytochrome P450 3A4 21 ECYSVFTNR; ETQIPLK; NKDNIDPYIYTPFGSGPR; DNIDPYIYTPFGSGPR; EMVPIIAQYGDVLVR; SLLSPTFTSGK; VDFLQLMIDSQNSK; DVEINGMFIPK; RPFGPVGFMK; VLQNFSFKPCK; LQEEIDAVLPNK; LSLGGLLQPEKPVVLK; LSLGGLLQPEK; ALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQK; APPTYDTVLQMEYLDMVVNETLR; LGIPGPTPLPFLGNILSYHK; SAISIAEDEEWKR; VWGFYDGQQPVLAITDPDMIK; SAISIAEDEEWK; GFCMFDMECHK; GWVVMIPSYALHR 1 IPI00465138.2
246 S_Total95_2667 IPI00160897.3 |TREMBL:Q969E5 |REFSEQ_NP:NP_006078 |ENSEMBL:ENSP00000264071 |H-INV:HIT000032930; HIT000036323 Tax_Id=9606 Tubulin, beta 4 21 NSSYFVEWIPNNVK; LAVNMVPFPR; SGPFGQIFRPDNFVFGQSGAGNNWAK; EIVHIQAGQCGNQIGAK; PDNFVFGQSGAGNNWAK; ISEQFTAMFR; TAVCDIPPR; FPGQLNADLR; NMMAACDPR; KLAVNMVPFPR; LTTPTYGDLNHLVSATMSGVTTCLR; MREIVHIQAGQCGNQIGAK; EIVHLQAGQCGNQIGAK; LHFFMPGFAPLTSR; EAESCDCLQGFQLTHSLGGGTGSGMGTLLISK; AVLVDLEPGTMDSVR; YLTVAAVFR; ALTVPELTQQMFDAK; MAATFIGNSTAIQELFK; IMNTFSVVPSPK; FWEVISDEHGIDPTGTYHGDSDLQLER 1 IPI00160897.3
247 S_Total95_2689 IPI00018931.6 |SWISS-PROT:Q96QK1 |TREMBL:Q561W2; Q5HYM2 |REFSEQ_NP:NP_060676 |ENSEMBL:ENSP00000299138; ENSP00000346781 |H-INV:HIT000009048; HIT000030875; HIT000002205; HIT000006924; HIT000026544; HIT000002870 Tax_Id=9606 Vacuolar protein sorting 35 21 LLDEAIQAVK; ACAELHQNVNVK; AELAELPLR; CFSEENHEPLR; ILVGTNLVR; IPVDTYNNILTVLK; IREDLPNLESSEETEQINK; LNLEHIATSSAVSK; NIIIALIDR; ERQELRILVGTNLVR; LFDIFSQQVATVIQSR; ENDAVTIQVLNQLIQK; ESPESEGPIYEGLIL; EDLPNLESSEETEQINK; NYLLQCTR; LSQLEGVNVER; FTLPPLVFAAYQLAFR; QDMPSEDVVSLQVSLINLAMK; HFHNTLEHLR; HFHPLFEYFDYESR; SEDPDQQYLILNTAR 1 IPI00018931.6
248 S_Total95_2702 IPI00178676.1 |TREMBL:Q8TCC6 |ENSEMBL:ENSP00000313313 Tax_Id=9606 DMGDH protein 21 LTSEDLSDDVFK; VSNIPVTAIR; WIEEEAVK; ESYGFNNIVGYPK; ELFESDLDR; DLEGSYYLR; ISYTGELGWELYHR; IVNAAGFWAR; LLDHLFANVIPK; NITDELGVLGVAGPQAR; TNWFEPVGSEYK; VAVTDLSPFGK; WTTTQYTEAK; YLSDWILHGEPPFDLIELDPNR; DGLLFGPYESQEK; SDGTWDVETPQGSMR; VSGLYQR; IQEMFPLLNMNK; VQDSWVTNGVPPGFGK; AWGLEMNCDTNPLEAGLEYFVK; MIGLEHPLIPVQHQYVVTSTISEVKALK 1 IPI00178676.1
249 S_Total95_2808 IPI00470467.4 |SWISS-PROT:P16435 |TREMBL:Q59ED7; Q9UDT3; Q63HL4 |REFSEQ_NP:NP_000932 |ENSEMBL:ENSP00000265302 |H-INV:HIT000042086 Tax_Id=9606 NADPH--cytochrome P450 reductase 21 EVGETLLYYGCR; NPFLAAVTTNR; DGALTQLNVAFSR; TNVLYELAQYASEPSEQELLR; FAVFGLGNK; SYENQKPPFDAK; YESGDHVAVYPANDSALVNQLGK; KKEEVPEFTK; NIIVFYGSQTGTAEEFANR; GVATNWLR; LKSYENQKPPFDAK; TALTYYLDITNPPR; IQTLTSSVR; IFELGLGDDDGNLEEDFITWR; VYVQHLLK; SDEDYLYR; HLMHLELDISDSK; EQFWPAVCEHFGVEATGEESSIR; KHPFPCPTSYR; HILAILQDCPSLRPPIDHLCELLPR; DVQNTFYDIVAELGAMEHAQAVDYIK 1 IPI00470467.4
250 S_Total95_3072 IPI00017283.2 |TREMBL:Q6PI85; Q86WU9; Q7L439; Q9NSE4; Q9H9Q8 |REFSEQ_NP:NP_060530 |ENSEMBL:ENSP00000303279 |H-INV:HIT000005939; HIT000004200; HIT000003662; HIT000034863 Tax_Id=9606 Mitochondrial isoleucine tRNA synthetase 21 SGDLYVLAADK; SCQTALVEILDVIVR; DQLGGWFQSSLLTSVAAR; SLGNVIHPDVVVNGGQDQSK; TALAEAELEYNPEHVSR; TGWISTSSIWK; TVIVHGFTLGEK; AVLEEGTDVVIK; VWGVPIPVFHHK; AVLEEGTDVVIKMLQTAKNLLK; RPYWCISR; ASPLLPANHVTMAK; LVEQHGSDIWWTLPPEQLLPK; IHFVPGWDCHGLPIEIK; LVHSYPYDWR; VASVASTLETTFETISTLSGVDLENGTCSHPLIPDK; FLINLEGGDIR; YTAESSDTLCPR; QQPDTELEIQQK; DSFLGSIPGK; DTVLLPQTSFPMK 1 IPI00017283.2
251 S_Total95_22 IPI00002520.1 |SWISS-PROT:P34897 |TREMBL:Q53ET4; Q5HYG8; Q8N1A5 |REFSEQ_NP:NP_005403 |ENSEMBL:ENSP00000333667 |H-INV:HIT000041618; HIT000036321; HIT000035537 Tax_Id=9606 Serine hydroxymethyltransferase, mitochondrial precursor 20 ISATSIFFESMPYK; YSEGYPGKR; EYSLQVLK; TGLIDYNQLALTAR; LIIAGTSAYAR; LGAPALTSR; VLELVSITANK; VVDFIDEGVNIGLEVK; YYGGAEVVDEIELLCQR; SGLIFYR; EIPYTFEDR; AMADALLER; AHLLADMAHISGLVAAK; ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR; INFAVFPSLQGGPHNHAIAAVAVALK; IMGLDLPDGGHLTHGYMSDVK; AALEALGSCLNNK; GLELIASENFCSR; GWTGQESLSDSDPEMWELLQR; PMF; Comb 1 IPI00002520.1
252 S_Total95_66 IPI00027107.3 |SWISS-PROT:P49411 |REFSEQ_NP:NP_003312 |ENSEMBL:ENSP00000322439 |H-INV:HIT000034759; HIT000030534 Tax_Id=9606 Tu translation elongation factor, mitochondrial 20 ELLTEFGYK; KYEEIDNAPEER; LLDAVDTYIPVPAR; DLEKPFLLPVEAVYSVPGR; GEETPVIVGSALCALEGR; GITINAAHVEYSTAAR; QIGVEHVVVYVNK; GEETPVIVGSALCALEGRDPELGLK; PFLLPVEAVYSVPGR; TIGTGLVTNTLAMTEEEK; TVVTGIEMFHK; GTVVTGTLER; AEAGDNLGALVR; ADAVQDSEMVELVELEIR; YEEIDNAPEER; DKPHVNVGTIGHVDHGK; GLVMVKPGSIKPHQK; HYAHTDCPGHADYVK; NMITGTAPLDGCILVVAANDGPMPQTR; PMF; Comb 1 IPI00027107.3
253 S_Total95_156 IPI00387144.4 |SWISS-PROT:P68363 |TREMBL:Q53GA7 |REFSEQ_NP:NP_006073 |ENSEMBL:ENSP00000336799 |H-INV:HIT000009790; HIT000029843; HIT000032865; HIT000034417; HIT000034276; HIT000023601; HIT000035299; HIT000032797; HIT000034418; HIT000030158; HIT000033881; HIT000037375; HIT000037783; HIT000009906; HIT000023465; HIT000041154; HIT000034968; HIT000034415 Tax_Id=9606 Tubulin alpha-ubiquitous chain 20 LISQIVSSITASLR; SIQFVDWCPTGFK; IHFPLATYAPVISAEK; VGINYQPPTVVPGGDLAK; FDGALNVDLTEFQTNLVPYPR; NLDIERPTYTNLNR; QIFHPEQLITGK; AVCMLSNTTAIAEAWAR; RNLDIERPTYTNLNR; YMACCLLYR; AYHEQLSVAEITNACFEPANQMVK; AFVHWYVGEGMEEGEFSEAR; QLFHPEQLITGK; QLFHPEQLITGKEDAANNYAR; DVNAAIATIK; EIIDLVLDR; TIGGGDDSFNTFFSETGAGK; AVFVDLEPTVIDEVR; DYEEVGVDSVEGEGEEEGEEY; PMF; Comb 1 IPI00387144.4
254 S_Total95_179-1 IPI00021440.1 |SWISS-PROT:P63261 |TREMBL:Q5U032; Q9UE89; Q96E67; Q562N8; Q562Z6; Q96FU6; Q562L5; Q9UMN3; Q6PJ43; Q562Y6; Q562L6; Q562P0; Q562N0; Q562U2; Q562N2; Q8WVW5; Q562M5; Q562Z4; Q562Y8; Q562V5; Q562X9; Q562M3; Q562R8; Q96DE1; Q562Z7; Q562L9; Q562U1; Q562S0 |REFSEQ_NP:NP_001605 |ENSEMBL:ENSP00000331514 |H-INV:HIT000034614; HIT000037318; HIT000035158; HIT000035998; HIT000037260; HIT000035619; HIT000030748; HIT000033226; HIT000038451; HIT000029492; HIT000036955 Tax_Id=9606 Actin, cytoplasmic 2 20 DLTDYLMK; EITALAPSTMK; IWHHTFYNELR; GYSFTTTAER; SYELPDGQVITIGNER; AVFPSIVGRPR; DLYANTVLSGGTTMYPGIADR; LCYVALDFEQEMATAASSSSLEK; QEYDESGPSIVHR; TTGIVMDSGDGVTHTVPIYEGYALPHAILR; AGFAGDDAPR; LDLAGRDLTDYLMK; AVFPSIVGR; KDLYANTVLSGGTTMYPGIADR; QEYDESGPSIVHRK; VAPEEHPVLLTEAPLNPK; DSYVGDEAQSK; HQGVMVGMGQK; CPEALFQPSFLGMESCGIHETTFNSIMK; PMF; Comb 1 IPI00021440.1
255 S_Total95_179-2 IPI00021439.1 |SWISS-PROT:P60709 |TREMBL:Q53G76; Q96HG5; Q96B34; Q53G99; Q53GK6 |REFSEQ_NP:NP_001092 |ENSEMBL:ENSP00000158302; ENSP00000349960 |H-INV:HIT000014625; HIT000030870; HIT000036874; HIT000031818; HIT000036240; HIT000030304; HIT000008649 Tax_Id=9606 Actin, cytoplasmic 1 20 DLTDYLMK; EITALAPSTMK; IWHHTFYNELR; GYSFTTTAER; SYELPDGQVITIGNER; AVFPSIVGRPR; DLYANTVLSGGTTMYPGIADR; LCYVALDFEQEMATAASSSSLEK; QEYDESGPSIVHR; TTGIVMDSGDGVTHTVPIYEGYALPHAILR; AGFAGDDAPR; LDLAGRDLTDYLMK; AVFPSIVGR; KDLYANTVLSGGTTMYPGIADR; QEYDESGPSIVHRK; VAPEEHPVLLTEAPLNPK; DSYVGDEAQSK; HQGVMVGMGQK; CPEALFQPSFLGMESCGIHETTFNSIMK; PMF; Comb 1 IPI00021439.1
256 S_Total95_351 IPI00299571.4 |SWISS-PROT:Q15084 |TREMBL:Q53RC7; Q6ZSH5 |REFSEQ_NP:NP_005733 |ENSEMBL:ENSP00000272227 |H-INV:HIT000030313; HIT000010200 Tax_Id=9606 Hypothetical protein FLJ45525 20 TGEAIVDAALSALR; GSFSEQGINEFLR; LAAVDATVNQVLASR; NLEPEWAAAASEVK; DVIELTDDSFDK; DGELPVEDDIDLSDVELDDLGK; DGELPVEDDIDLSDVELDDLGKDEL; ALDLFSDNAPPPELLEIINEDIAK; GSTAPVGGGAFPTIVER; KDVIELTDDSFDK; NSYLEVLLK; VGAVDADKHHSLGGQYGVQGFPTIK; GESPVDYDGGR; HHSLGGQYGVQGFPTIK; EPWDGRDGELPVEDDIDLSDVELDDLGKDEL; HHSLGGQYGVQGFPTIKIFGSNKNR; TCEEHQLCVVAVLPHILDTGAAGR; GSTAPVGGGAFPTIVEREPWDGR; NRPEDYQGGR; PMF; Comb 1 IPI00299571.4
257 S_Total95_361 IPI00027146.1 |SWISS-PROT:P49448 |TREMBL:Q9BSD0 |REFSEQ_NP:NP_036216 |ENSEMBL:ENSP00000327589 |H-INV:HIT000032218 Tax_Id=9606 Glutamate dehydrogenase 2, mitochondrial precursor 20 YSTDVSVDEVK; CAVVDVPFGGAK; LQHGSILGFPK; TFVVQGFGNVGLHSMR; ALASLMTYK; CIAVGESDGSIWNPDGIDPK; PISQGGIHGR; FTMELAK; DDGSWEVIEGYR; IIAEGANGPTTPEADK; RDDGSWEVIEGYR; TAAYVNAIEK; YNLGLDLR; IIAEGANGPTTPEADKIFLER; IIKPCNHVLSLSFPIR; MVEGFFDR; PCNHVLSLSFPIR; ALLPSRAGPAALGSAANHSAALLGR; NLNHVSYGR; Comb 1 IPI00027146.1
258 S_Total95_468 IPI00022793.4 |SWISS-PROT:P55084 |TREMBL:Q53TA6; Q9T2V8 |REFSEQ_NP:NP_000174 |ENSEMBL:ENSP00000325136 |H-INV:HIT000020133; HIT000036785; HIT000041157; HIT000038051 Tax_Id=9606 Trifunctional enzyme beta subunit, mitochondrial precursor 20 DFMYVSQDPK; DQLLLGPTYATPK; AQDEGLLSDVVPFK; FNNWGGSLSLGHPFGATGCR; KAQDEGLLSDVVPFK; LAAAFAVSR; LEQDEYALR; AQDEGLLSDVVPFKVPGK; DQLLLGPTYATPKVLEK; AMDSDWFAENYMGR; EGGQYGLVAACAAGGQGHAMIVEAYPK; AGLTMNDIDAFEFHEAFSGQILANFK; PYGTVTAANSSFLTDGASAMLIMAEEK; EAALGAGFSDK; TPFLLSGTSYK; EVVDYIIFGTVIQEVK; NVVVVDGVR; AALTGLLHR; TPFLLSGTSYKDLMPHDLAR; Comb; PMF 1 IPI00022793.4
259 S_Total95_528 IPI00027701.3 |SWISS-PROT:P16219 |REFSEQ_NP:NP_000008 |ENSEMBL:ENSP00000242592 |H-INV:HIT000040042 Tax_Id=9606 Acyl-CoA dehydrogenase, short-chain specific, mitochondrial precursor 20 AEGDSWVLNGTK; EHLFPAAQVK; ELFPIAAQVDK; ITEIYEGTSEIQR; GSSTANLIFEDCR; QAWVTPFTSGDK; ELFPIAAQVDKEHLFPAAQVK; GISAFLVPMPTPGLTLGK; IGIASQALGIAQTALDCAVNYAENR; LADMALALESAR; LVIAGHLLR; DSILGEPGMGFK; IGCFALSEPGNGSDAGAASTTAR; LQVIQFK; AWITNAWEASAAVVFASTDR; IAMQTLDMGR; MAFGAPLTK; GCASTGVIMSVNNSLYLGPILK; LAASEAATAISHQAIQILGGMGYVTEMPAER; PMF; Comb 1 IPI00027701.3
260 S_Total95_535 IPI00096066.2 |SWISS-PROT:Q96I99 |REFSEQ_NP:NP_003839 |ENSEMBL:ENSP00000307432 Tax_Id=9606 Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursor 20 DPNVVGQLAK; FFVADTANEALEAAK; LYNLFLK; EQIDIFEGIK; IDATQVEVNPFGETPEGQVVCFDAK; FFVADTANEALEAAKR; SENEPIENEAAK; VMVAEALDISR; MAENLGFVGPLK; VEAILVNIFGGIVNCAIIANGITK; LEGTNVQEAQK; ILNNSGLPITSAIDLEDAAK; ETYLAILMDR; SCNGPVLVGSPQGGVDIEEVAASNPELIFK; ILNNSGLPITSAIDLEDAAKKAVASVAK; ELELKVPLVVR; EAQVYQAFK; INFDDNAEFR; PANFLDLGGGVK; PMF; Comb 1 IPI00096066.2
261 S_Total95_633-1 IPI00032103.3 |SWISS-PROT:P50440-1 |TREMBL:Q53EQ4 |REFSEQ_NP:NP_001473 |ENSEMBL:ENSP00000303263 |H-INV:HIT000022909; HIT000031728; HIT000023223 Tax_Id=9606 Splice Isoform Mitochondrial of Glycine amidinotransferase, mitochondrial precursor 20 AENACVPPFTIEVK; RGTLQSYLD; VMVDANEVPIQK; AVAEIEEMCNILK; FVTTEFEPCFDAADFIR; AGWTIITPPTPIIPDDHPLWMSSK; DCPVSSYNEWDPLEEVIVGR; NANSLGGGFHCWTCDVR; RPDPIDWSLK; TPDFESTGLYSAMPR; NSCAADDKATEPLPK; DILIVVGNEIIEAPMAWR; SQVTNYLGIEWMR; KAVAEIEEMCNILK; PTMADELYNQDYPIHSVEDR; HLAPDYR; DPNPMHIDATFNIIGPGIVLSNPDR; DPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFK; RVMVDANEVPIQK; PMF; Comb 1 IPI00032103.3
262 S_Total95_633-2 IPI00216279.1 |SWISS-PROT:P50440-2 Tax_Id=9606 Splice Isoform Cytoplasmic of Glycine amidinotransferase, mitochondrial precursor 20 AENACVPPFTIEVK; RGTLQSYLD; VMVDANEVPIQK; AVAEIEEMCNILK; FVTTEFEPCFDAADFIR; AGWTIITPPTPIIPDDHPLWMSSK; DCPVSSYNEWDPLEEVIVGR; NANSLGGGFHCWTCDVR; RPDPIDWSLK; TPDFESTGLYSAMPR; NSCAADDKATEPLPK; DILIVVGNEIIEAPMAWR; SQVTNYLGIEWMR; KAVAEIEEMCNILK; PTMADELYNQDYPIHSVEDR; HLAPDYR; DPNPMHIDATFNIIGPGIVLSNPDR; DPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFK; RVMVDANEVPIQK; PMF; Comb 1 IPI00216279.1
263 S_Total95_799 IPI00384444.4 |SWISS-PROT:P02533 |TREMBL:Q9UBN2; Q13092; Q53XY3; Q9UBN3 |REFSEQ_NP:NP_000517 |ENSEMBL:ENSP00000167586 |H-INV:HIT000031101; HIT000038549 Tax_Id=9606 Keratin, type I cytoskeletal 14 20 LAADDFR; ALEEANADLEVK; LASYLDK; LEQEIATYR; VLDELTLAR; TRLEQEIATYR; LASYLDKVR; ASLENSLEETK; EVATNSELVQSGK; ISSVLAGGSCR; GSCGIGGGIGGGSSR; LLEGEDAHLSSSQFSSGSQSSR; VTMQNLNDR; DAEEWFFTK; DAEEWFFTKTEELNR; ILTATVDNANVLLQIDNAR; APSTYGGGLSVSSSR; TKYETELNLR; NKILTATVDNANVLLQIDNAR; PMF 1 IPI00384444.4
264 S_Total95_898 IPI00103467.3 |SWISS-PROT:P30837 |TREMBL:Q9BV45; Q8WX76 |REFSEQ_NP:NP_000683 |ENSEMBL:ENSP00000259658 |H-INV:HIT000030521 Tax_Id=9606 Aldehyde dehydrogenase X, mitochondrial precursor 20 VTLELGGK; EEIFGPVQPLFK; VLGYIQLGQK; VAFTGSTEVGHLIQK; LLNLLADLVER; TFPTVNPTTGEVIGHVAEGDR; VAEQTPLSALYLASLIK; VGNPFELDTQQGPQVDKEQFER; YGLAAAVFTR; GFFIKPTVFGGVQDDMR; IAKEEIFGPVQPLFK; TFVEESIYNEFLER; VGNPFELDTQQGPQVDK; IEEVVER; LAPALATGNTVVMK; EAGFPPGVVNIITGYGPTAGAAIAQHMDVDK; KVGNPFELDTQQGPQVDKEQFER; HEPVGVCGQIIPWNFPLVMQGWK; KTFPTVNPTTGEVIGHVAEGDR; PMF; Comb 1 IPI00103467.3
265 S_Total95_1055 IPI00217975.3 |SWISS-PROT:P20700 |TREMBL:Q6DC98 |REFSEQ_NP:NP_005564 |ENSEMBL:ENSP00000261366 |H-INV:HIT000035744 Tax_Id=9606 Lamin B1 20 LLEGEEER; ALYETELADAR; SMYEEEINETR; CQSLTEDLEFRK; DQMQQQLNDYEQLLDVK; IQELEDLLAK; LREYEAALNSK; IESLSSQLSNLQK; NQNSWGTGEDVK; SLETENSALQLQVTER; DAALATALGDKK; LSSEMNTSTVNSAR; NTSEQDQPMGGWEMIR; GRELTGLKALYETELADAR; AEHDQLLLNYAK; SLEGDLEDLKDQIAQLEASLAAAK; CQSLTEDLEFR; TTIPEEEEEEEEAAGVVVEEELFHQQGTPR; LYKEELEQTYHAK; Comb; PMF 1 IPI00217975.3
266 S_Total95_1078 IPI00004671.1 |SWISS-PROT:Q14789 |REFSEQ_NP:NP_004478 |ENSEMBL:ENSP00000341848 |H-INV:HIT000019406 Tax_Id=9606 Golgi autoantigen, golgin subfamily B member 1 20 DQLLSQVKELSMVTELR; LSSQITLLEAQNR; SLQSQLQNKESEVLEGAER; SSSAEESGQDVLENTFSQK; VAAENALSVAEEQIR; NELLESEMKNLK; EQVEEDNEVSSGLK; AQGGTVLPTEPQSEEQLSK; EIEAEKVELELK; SSTEEEMEIEKIK; DQLIQEAAAENNK; DSLSEEVQDLK; LALEGLTEDKEKLVK; MVQLNEEKFSLGVEIK; NEQAVQSAQTIQQLEDQLQQK; RIAELEEELVCVQK; EVSEISIVDIANK; DKEVQQLQENLDSTVTQLAAFTK; VSISQLTRQVTALQEEGTLGLYHAQLKVK; Comb; PMF 1 IPI00004671.1
267 S_Total95_1247-1 IPI00296907.3 |SWISS-PROT:Q15067-1 |REFSEQ_NP:NP_009223 |ENSEMBL:ENSP00000301608 Tax_Id=9606 Splice Isoform 1 of Acyl-coenzyme A oxidase 1, peroxisomal 20 TSNHAIVLAQLITK; FGYDEIDNGYLK; DSASFNPELLTHILDGSPEK; EVAWNLTSVDLVR; SDAVALVDAFDFQDVTLGSVLGR; YDGNVYENLFEWAK; AFTSWTANTGIEACR; LVCGMVSYLNDLPSQR; VKELLTLIR; YAQVKPDGTYVKPLSNK; EIENMILNDPDFQHEDLNFLTR; INEGIGQGDLSELPELHALTAGLK; EFGIADPDEIMWFK; PLPGITVGDIGPK; EIGTHKPLPGITVGDIGPK; ERDSASFNPELLTHILDGSPEK; CYGLHAFIVPIR; GLETTATYDPETQEFILNSPTVTSIK; GLQIIGTYAQTEMGHGTHLR; Comb; PMF 1 IPI00296907.3
268 S_Total95_1247-2 IPI00477729.1 |SWISS-PROT:Q15067-2 |REFSEQ_NP:NP_004026 |ENSEMBL:ENSP00000293217 |H-INV:HIT000033955 Tax_Id=9606 Splice Isoform 2 of Acyl-coenzyme A oxidase 1, peroxisomal 20 TSNHAIVLAQLITK; FGYDEIDNGYLK; DSASFNPELLTHILDGSPEK; EVAWNLTSVDLVR; SDAVALVDAFDFQDVTLGSVLGR; YDGNVYENLFEWAK; AFTSWTANTGIEACR; LVCGMVSYLNDLPSQR; VKELLTLIR; YAQVKPDGTYVKPLSNK; EIENMILNDPDFQHEDLNFLTR; INEGIGQGDLSELPELHALTAGLK; EFGIADPDEIMWFK; PLPGITVGDIGPK; EIGTHKPLPGITVGDIGPK; ERDSASFNPELLTHILDGSPEK; CYGLHAFIVPIR; GRPEPLDLHLGMFLPTLLHQATAEQQER; GLETTATYDPETQEFILNSPTVTSIK; Comb; PMF 1 IPI00477729.1
269 S_Total95_1313 IPI00465085.1 |TREMBL:Q6XQN4; Q8N5E8; Q8WY82; Q6XQN6; Q9BRG0; Q6XQN5 |ENSEMBL:ENSP00000276844 |H-INV:HIT000041554; HIT000021857 Tax_Id=9606 Nicotinate phosphoribosyltransferase-like protein 20 LQALVNSLCAGQSP; LDSGDLLQQAQEIR; AFQGLLDTYSVWR; ALAQLSLSR; ALDCSEVTVR; DAAEFELFFR; DADVQFLASVLPPDTDPAFFEHLR; LTEDPEKQTLPGSK; PLLTDLYQATMALGYWR; SGLPNFLAVALALGELGYR; AAFVAYALAFPR; PAQVEPLLR; RCPFGGAFALAAGLR; LCLQQGQLCEPLPSLAESR; AAAAQFQVPWLESVLIVVSNNIDEEALAR; LVAVGGQPR; CPFGGAFALAAGLR; LLGSDGSPLMDMLQLAEEPVPQAGQELR; LAQEGSEVNVIGIGTSVVTCPQQPSLGGVYK; Comb; PMF 1 IPI00465085.1
270 S_Total95_1315 IPI00465430.4 |SWISS-PROT:P12956 |TREMBL:Q6IC76; Q6FG89; Q9UCQ2 |REFSEQ_NP:NP_001460 |ENSEMBL:ENSP00000353192 |H-INV:HIT000038319; HIT000033731; HIT000034754; HIT000035696; HIT000012400 Tax_Id=9606 G22P1 protein 20 NIYVLQELDNPGAK; KQELLEALTK; NIPPYFVALVPQEEELDDQK; FDDPGLMLMGFKPLVLLK; ILELDQFK; SDSFENPVLQQHFR; TEGDEEAEEEQEENLEASGDYK; TFNTSTGGLLLPSDTK; ELVYPPDYNPEGK; VEYSEEELK; IQVTPPGFQLVFLPFADDK; KPGGFDISLFYR; DIISIAEDEDLR; DLLAVVFYGTEK; DTGIFLDLMHLK; FDDPGLMLMGFK; LGSLVDEFK; NLEALALDLMEPEQAVDLTLPK; IQVTPPGFQLVFLPFADDKR; Comb 2 IPI00465430.4, IPI00478017.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home