Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
1 IPI00000001.2 Isoform Long of Double-stranded RNA-binding protein Staufen homolog 1 ER(SP); Cyto(SP,GO) - - - - - 2.88E-02 (VQGFQVEYKDFPKNNK;MSQVQVQVQNPSAALSGSQILNK) 1 IPI00000001.2
2 IPI00000005.1 GTPase NRas precursor Cyto(G1); PM(SP,GO) - 2.56E-01 (LVVVGAGGVGK;SALTIQLIQNHFVDEYDPTIEDSYR;SALTIQLIQNHFVDEYDPTIEDSYRK;SYGIPFIETSAK;TGEGFLCVFAINNSK;SFADINLYR) - - 2.37E-01 (LVVVGAGGVGK;QGVEDAFYTLVR;SALTIQLIQNHFVDEYDPTIEDSYR;SALTIQLIQNHFVDEYDPTIEDSYRK;SYGIPFIETSAK;SFADINLYR) - 1 IPI00000005.1
3 IPI00000006.1 GTPase HRas precursor Cyto(G2,GO); PM(SP,GO) - - - - 1.94E-01 (LVVVGAGGVGK;QGVEDAFYTLVR;SALTIQLIQNHFVDEYDPTIEDSYR;SALTIQLIQNHFVDEYDPTIEDSYRK;SFEDIHQYR) - 2 IPI00796569.1, IPI00000006.1
4 IPI00000015.2 Splicing factor, arginine/serine-rich 4 Nucl(SP,GO) - 7.95E-03 (DADDAVYELNGK;NEGVIEFVSYSDMK) - - - 5.75E-02 (LIVENLSSR;DADDAVYELNGK;NGYGFVEFDDLR) 1 IPI00000015.2
5 IPI00000030.1 Isoform Delta-1 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform Cyto(SP); Nucl(SP,GO) - 2.41E-02 (AGLNEMVEYITHSR;FLESPDFQPNIAK;SLSVYHPQLAYCVVQFLEK) - - - - 3 IPI00219544.1, IPI00219543.1, IPI00000030.1
6 IPI00000041.1 Rho-related GTP-binding protein RhoB precursor Nucl(SP); PM(SP,GO); Cyto(GO) - 2.35E-02 (DEFPEVYVPTVFENYVADIEVDGK;TCLLIVFSK;QVELALWDTAGQEDYDR) - - - - 1 IPI00000041.1
7 IPI00000057.1 Conserved oligomeric Golgi complex component 2 Cyto(G2) - 1.16E-02 (IIQDLSDSCFGFLK;TQLVYVVADLDKLQEQLPELLEIIKPK) - - - - 2 IPI00000057.1, IPI00643424.1
8 IPI00000070.1 Low-density lipoprotein receptor precursor PM(G2,SP,GO) - - - - 1.81E-02 (AHGVSSYDTVISR;NINSINFDNPVYQK) - 2 IPI00000070.1, IPI00792252.1
9 IPI00000105.3 Major vault protein ER(G1); Cyto(SP,GO,HPA); Nucl(SP) - 3.52E-02 (KEVEVVEIIQATIIR;LAQDPFPLYPGEVLEK;IPPYHYIHVLDQNSNVSR;VASGPSPGEGISPQSAQAPQAPGDNHVVPVLR;SFFLQPGEQLEQGIQDVYVLSEQQGLLLR) - 3.83E-01 (ALQPLEEGEDEEK;DAQGLVLFDVTGQVR;DITPLQVVLPNTALHLK;DLAVAGPEMQVK;ELLELEALSMAVESTGTAK;ELPPGVEELLNK;GAVASVTFDDFHK;IPPYHYIHVLDQNSNVSR;KEVEVVEIIQATIIR;LAQDPFPLYPGEVLEK;QAIPLDENEGIYVQDVK;STLITDGSTPIN 3.05E-02 (LAQDPFPLYPGEVLEK;DITPLQVVLPNTALHLK) 7.23E-02 (DAQGLVLFDVTGQVR;KEVEVVEIIQATIIR;LAQDPFPLYPGEVLEK;DITPLQVVLPNTALHLK;TAVFGFETSEAK;VASGPSPGEGISPQSAQAPQAPGDNHVVPVLR) 1 IPI00000105.3
10 IPI00000133.1 Bcl-2-related ovarian killer protein ER(G1) 1.74E-01 (AAFFVLLPER;AGLSWSAPER;TLATWLR;LAEVCAVLLR) - - 1.58E-01 (AAFFVLLPER;SSVFAAEIMDAFDR;LGDELEMIRPSVYR) 8.46E-02 (AAFFVLLPER;SSVFAAEIMDAFDR) - 1 IPI00000133.1
11 IPI00000151.1 Integrin beta-6 precursor Nucl(G1); PM(GO) - - - - - 1.47E-02 (IGFGSFVEK;EMSKLTSNFRLGFGSFVEK) 1 IPI00000151.1
12 IPI00000155.5 Cytokine-like nuclear factor n-pac Nucl(SP) - - - - - 3.64E-01 (DLVLGPSGVLQGIRPGK;TSFFLGEVGNAAK;FQQAVDAVEEFLR;TPAEVVSTCDITFACVSDPK) 4 IPI00000155.5, IPI00644210.1, IPI00647134.1, IPI00647648.1
13 IPI00000240.2 Group XIIB secretory phospholipase A2-like protein precursor ER(G1) - - - 5.40E-01 (GSFESVNSYFDSFLELLGGK;VPESMDLGIPAMTK) 3.48E-01 (GSFESVNSYFDSFLELLGGK;VPESMDLGIPAMTK) - 2 IPI00000240.2, IPI00797040.1
14 IPI00000305.3 Mediator of RNA polymerase II transcription, subunit 11 homolog Nucl(G1) - - - - - 2.15E-01 (EIGAILQNAGTVILELSK;YLTQVATGQPHEGSSYSSR) 1 IPI00000305.3
15 IPI00000335.1 Histidine triad nucleotide-binding protein 2 Mito(SP,MitoP2) - - 4.55E-01 (AQQATPGGAAPTIFSR;LGAQSVYHLHIHVLGGR;SLPADILYEDQQCLVFR;DVAPQAPVHFLVIPK;ISQAEEEDQQLLGHLLLVAK) - - 4.76E-01 (AQQATPGGAAPTIFSR;LGAQSVYHLHIHVLGGR;DVAPQAPVHFLVIPK;ISQAEEEDQQLLGHLLLVAK) 1 IPI00000335.1
16 IPI00000494.5 60S ribosomal protein L5 Cyto(SP,GO); Nucl(SP,GO) - 5.81E-01 (GAVDGGLSIPHSTK;HIMGQNVADYMR;VFGALKGAVDGGLSIPHSTK;VGLTNYAAAYCTGLLLAR;DIICQIAYAR;YLMEEDEDAYKK;NKYNTPK) - 1.01E+00 (GAVDGGLSIPHSTK;HIMGQNVADYMR;KHIMGQNVADYMR;NSVTPDMMEEMYK;NSVTPDMMEEMYKK;YLMEEDEDAYKK) 3.96E-01 (GAVDGGLSIPHSTK;HIMGQNVADYMR;VFGALKGAVDGGLSIPHSTK) 4.27E-02 (VGLTNYAAAYCTGLLLAR;GAVDGGLSIPHSTK) 1 IPI00000494.5
17 IPI00000495.1 PNAS-125 Cyto(G2) - 8.09E-02 (FLEGELIHDLLTIFVSAK;ALKDPNAFLFDHLLTLKPVK) - 4.29E-02 (ALKDPNAFLFDHLLTLKPVK;DFIDSLGLLHEQNMAK) - - 1 IPI00000495.1
18 IPI00000581.5 Hypothetical protein DKFZp564E242 Cyto(G1) - 7.67E-01 (EYAEDDNIYQQK;FFEHFIEGGR;QTSVADLLASFNDQSTSDYLVVYLR;SKEDLVSQGFTEFTIEDFHNTFMDLIEQVEK;VYLLYRPGHYDILYK;GEGGTTNPHIFPEGSEPK;IQQEIAVQNPLVSER;LLTSGYLQR;PGHYDILYK;LELSVLYK) - - - - 1 IPI00000581.5
19 IPI00000643.1 BAG family molecular chaperone regulator 2 ER(G1) - - - 9.04E-02 (LLESLDQLELR;LLEHSKGAGSK;EAATAVEQEKEILLEMIHSIQNSQDMR) 1.21E-01 (EAATAVEQEKEILLEMIHSIQNSQDMR;EILLEMIHSIQNSQDMR;LLESLDQLELR;FLDDLGNAK) - 1 IPI00000643.1
20 IPI00000655.1 Solute carrier family 16, member 2 PM(G2,GO) - - - - 1.33E-01 (MGRGGGGLDVGGGGEGSRDR;LGLANGVVSAGSSIFSMSFPFLIR;VHEPEPTPTVETR) - 1 IPI00000655.1
21 IPI00000663.1 Isoform Mitochondrial of Malonyl-CoA decarboxylase, mitochondrial precursor Mito(G1,SP,MitoP2); Cyto(SP) - 2.35E-02 (YFLEETGPNSTSYLGSK;TPAPAEGQCADFVSFYGGLAETAQR;EAAVLLQAEDR) 9.52E-01 (ASEQVLSLVAQFQK;EISEITGGPINETLK;LLLSSSEWVQSEK;TPAPAEGQCADFVSFYGGLAETAQR;WLLGLLNSQTK;EAAVLLQAEDR;EFPHLGVFSSLSPIPGFTK;EKTPAPAEGQCADFVSFYGGLAETAQR;GFGVDHGQVAEQSAGVLHLR;LCAWYLYGEK;YFLEETGPNSTSYLG - - - 2 IPI00000663.1, IPI00759655.1
22 IPI00000684.4 Isoform AGX2 of UDP-N-acetylhexosamine pyrophosphorylase Cyto(SP,GO,HPA); Nucl(GO,HPA); PM(GO,HPA) - 3.13E-01 (IPYVDTQGQLIKPDKPNGIK;FVFDIFQFAK;FVVYEVLREDEFSPLK;KFVVYEVLREDEFSPLK;SETITADVNHNLK;TNPTEPVGVVCR;VAVLLLAGGQGTR;DQDQLQAWESEGLFQISQNK;DVVNVYEPQLQHHVAQK;GIWSIHVYCVDNILVK;LLFNAGNIANHFFTVPFLR;VDGVYQ - - - - 2 IPI00000684.4, IPI00607787.1
23 IPI00000686.2 Probable RNA-binding protein 19 Cyto(G1,HPA); Nucl(SP,GO,HPA) - 8.14E-03 (GSVAVRVALGETQLVQEVR;ELFSTFGELK) - - - 1.46E-02 (ILGENEEEEDLAESGR;EERFRQLFAAFGTLTDCSLK) 1 IPI00000686.2
24 IPI00000690.1 Isoform 1 of Programmed cell death protein 8, mitochondrial precursor Mito(G1,SP,GO,MitoP2); Cyto(SP); Nucl(SP) 5.01E+00 (AALSASEGEEVPQDK;ALGTEVIQLFPEK;APSHVPFLLIGGGTAAFAAAR;ELWFSDDPNVTK;IIKDGEQHEDLNEVAK;ISGLGLTPEQK;KAALSASEGEEVPQDK;KVETDHIVAAVGLEPNVELAK;LNDGSQITYEK;SIYFQPPSFYVSAQDLPHIENGGVAVLTGK;SNIWVAGDAACFYD 6.66E-02 (AALSASEGEEVPQDK;KAALSASEGEEVPQDK;SITIIGGGFLGSELACALGR;ALGTEVIQLFPEK;KVETDHIVAAVGLEPNVELAK;SIYFQPPSFYVSAQDLPHIENGGVAVLTGK) 4.14E+00 (AALSASEGEEVPQDK;APSHVPFLLIGGGTAAFAAAR;ELWFSDDPNVTK;IIKDGEQHEDLNEVAK;KAALSASEGEEVPQDK;SITIIGGGFLGSELACALGR;TGGLEIDSDFGGFR;ALGTEVIQLFPEK;ISGLGLTPEQK;KVETDHIVAAVGLEPNVELAK;SIYFQPPSFYVSAQDLPHIEN 3.14E-01 (AALSASEGEEVPQDK;APSHVPFLLIGGGTAAFAAAR;ALGTEVIQLFPEK;ELWFSDDPNVTK;ISGLGLTPEQK;KVETDHIVAAVGLEPNVELAK;TGGLEIDSDFGGFR;VMPNAIVQSVGVSSGK;SIYFQPPSFYVSAQDLPHIENGGVAVLTGK;IIKDGEQHEDLNEVAK) 7.41E-01 (AALSASEGEEVPQDK;APSHVPFLLIGGGTAAFAAAR;ALGTEVIQLFPEK;ISGLGLTPEQK;KAALSASEGEEVPQDK;KVETDHIVAAVGLEPNVELAK;LNDGSQITYEK;TGGLEIDSDFGGFR;VLIVSEDPELPYMRPPLSK;VMPNAIVQSVGVSSGK;GVIFYLR;SIYFQPPSFYVSAQD 5.06E-01 (AALSASEGEEVPQDK;APSHVPFLLIGGGTAAFAAAR;ATAQDNPKSATEQSGTGIR;IIKDGEQHEDLNEVAK;KAALSASEGEEVPQDK;SITIIGGGFLGSELACALGR;TGGLEIDSDFGGFR;ALGTEVIQLFPEK;KVETDHIVAAVGLEPNVELAK;ELWFSDDPNVTK;SIYFQPPSFYVSA 1 IPI00000690.1
25 IPI00000691.1 Claudin-1 ER(G1); PM(GO) - - - - 2.46E-01 (IVQEFYDPMTPVNAR;VFDSLLNLSSTLQATR) - 1 IPI00000691.1
26 IPI00000695.1 Guanine nucleotide-binding protein alpha-14 subunit Cyto(G2); PM(GO) - - - 2.99E-02 (VPTTGIIEYPFDLENIIFR;EYQLSDSAKYYLTDIDR) - - 1 IPI00000695.1
27 IPI00000728.3 Isoform 1 of Ubiquitin carboxyl-terminal hydrolase 15 Cyto(G2) - 3.69E-02 (EHLIDELDYILLPTEGWNK;ISVTFDPFCYLTLPLPMK;NDSIIVDIFHGLFK;RNDSIIVDIFHGLFK;KVVEQGMFVKHCK) - - - - 3 IPI00000728.3, IPI00219504.1, IPI00219505.1
28 IPI00000760.1 NG,NG-dimethylarginine dimethylaminohydrolase 2 Cyto(G1) - 7.33E-01 (AGAGLSSLCLVLSTRPHS;DFAVSTVPVSGPSHLR;EFFVGLSK;GAEIVADTFR;GGGDLPNSQEALQK;GVPESLASGEGAGAGLPALDLAK;IVEIGDENATLDGTDVLFTGR;LSDVTLVPVSCSELEK) - - 2.53E-01 (DFAVSTVPVSGPSHLR;GVPESLASGEGAGAGLPALDLAK;GGGDLPNSQEALQK;PGLPGVPPFLLHR) - 1 IPI00000760.1
29 IPI00000783.1 Isoform 1 of Proteasome subunit beta type 8 precursor Cyto(G1) - 1.47E+00 (FQHGVIAAVDSR;GPGLYYVDEHGTR;KGPGLYYVDEHGTR;VESTDVSDLLHQYR;ASAGSYISALR) - 6.78E-02 (KGPGLYYVDEHGTR;VESTDVSDLLHQYR;FQHGVIAAVDSR) 1.46E-01 (ASAGSYISALR;VESTDVSDLLHQYR) 6.91E-01 (FQHGVIAAVDSR;GPGLYYVDEHGTR;KGPGLYYVDEHGTR;VESTDVSDLLHQYR;ASAGSYISALR) 3 IPI00000783.1, IPI00215824.1, IPI00640155.1
30 IPI00000787.1 Isoform LMP2.L of Proteasome subunit beta type 9 precursor Cyto(G1) - 4.49E-01 (DGSSGGVIYLVTITAAGVDHR;IYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVR;VILGNELPK) - - - - 2 IPI00000787.1, IPI00170899.1
[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home