Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
271 IPI00005859.2 Cytokeratin type II Mito(G1) - 8.30E-02 (LALDVEIATYR;YEELQVTAGR;FLEQQNKVLETK;NLDLDSIIAEVK;FASFIDK;QCSSLQTAIADAEQR) 1.61E-01 (NLDLDSIIAEVK;FLEQQNKVLETK) - - - 1 IPI00005859.2
272 IPI00005861.1 Isoform 1 of U4/U6 small nuclear ribonucleoprotein Prp3 Nucl(SP,GO,HPA); Cyto(GO,HPA) - - - - - 2.03E-02 (AADHLKPFLDDSTLR;VLGTEAVQDPTK) 2 IPI00005861.1, IPI00377152.1
273 IPI00005914.3 Carbohydrate kinase-like protein Cyto(G1) - 3.58E-01 (SYDAAGTIHDYVVAMLCGLPR;AAPDDPSGFAVLASCAR;AEAAVESAVAGPQGR;AVSHLVTWQDGR;DTHLTITPTVLGER;HLPDQLASVTR;ILQALHECLAALPR;ISSSDLSLGHVTR;PITLGIDLGTTSVK;SSGFPVHLLPDIAEPGSVAGR;CSSEFLASLPQPK) - - - - 1 IPI00005914.3
274 IPI00005918.2 Alpha-methyl-acyl-CoA racemase Mito(SP,MitoP2) - 1.98E-01 (RDPFIGEHTEEILEEFGFSR;DPFIGEHTEEILEEFGFSR;GSFITSEEQDVSPR;LAGHDINYLALSGVLSK;LSGFGQSGSFCR;PAPLLLNTPAIPSFK;LQLGPEILQR;EEIYQLNSDK;LAGHDINYLALSGVLSKIGR) 3.55E-01 (RDPFIGEHTEEILEEFGFSR;GSFITSEEQDVSPR;LAGHDINYLALSGVLSK;PAPLLLNTPAIPSFK;LSGFGQSGSFCR) - - - 1 IPI00005918.2
275 IPI00005923.3 Isoform 1 of Pancreatic lipase-related protein 1 precursor Cyto(G2) - 2.08E-02 (FFLNTGEASNFARWR;TPGLSRITGLDPVEASFESTPEEVR) - - - - 1 IPI00005923.3
276 IPI00005948.1 hypothetical protein LOC84245 isoform 1 Cyto(SP); Nucl(SP) - 2.70E-02 (IAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELR;LEHAFCTETRPYNQGAR) - - - - 1 IPI00005948.1
277 IPI00005966.6 13kDa differentiation-associated protein variant (Fragment) Mito(SP,GO,HPA); Cyto(HPA) - - 9.76E-02 (FNVTGTPEQYVPYSTTR;IQEWIPPSTPYK) 1.04E-01 (GLQQITGHGGLR;FNVTGTPEQYVPYSTTR) 1.86E-01 (FNVTGTPEQYVPYSTTR;GLQQITGHGGLR) - 1 IPI00005966.6
278 IPI00005969.2 F-actin capping protein alpha-1 subunit Cyto(G1,GO); Mito(G1) 1.79E+00 (DVQDSLTVSNEAQTAK;EASDPQPEEADGGLK;FITHAPPGEFNEVFNDVR;FTITPPTAQVVGVLK;IEGYEDQVLITEHGDLGNSR;IQVHYYEDGNVQLVSHK;LLLNNDNLLR) 1.32E+00 (FITHAPPGEFNEVFNDVR;DHYSNGFCTVYAK;DVQDSLTVSNEAQTAK;EASDPQPEEADGGLK;FTITPPTAQVVGVLK;IEGYEDQVLITEHGDLGNSR;IQVHYYEDGNVQLVSHK;TIDGQQTIIACIESHQFQPK;EGAAHAFAQYNMDQFTPVK;LLLNNDNLLR) - 3.63E-01 (DVQDSLTVSNEAQTAK;EASDPQPEEADGGLK;EGAAHAFAQYNMDQFTPVK;FITHAPPGEFNEVFNDVR;FTITPPTAQVVGVLK;IEGYEDQVLITEHGDLGNSR;IQVHYYEDGNVQLVSHK;LLLNNDNLLR) 5.62E-01 (DVQDSLTVSNEAQTAK;EASDPQPEEADGGLK;EGAAHAFAQYNMDQFTPVK;FITHAPPGEFNEVFNDVR;FTITPPTAQVVGVLK;IEGYEDQVLITEHGDLGNSR;LLLNNDNLLR) 5.42E-01 (DHYSNGFCTVYAK;DVQDSLTVSNEAQTAK;EASDPQPEEADGGLK;FITHAPPGEFNEVFNDVR;FTITPPTAQVVGVLK;IEGYEDQVLITEHGDLGNSR;LLLNNDNLLR) 1 IPI00005969.2
279 IPI00005978.7 Splicing factor, arginine/serine-rich 2 Nucl(SP,GO) - 1.30E-01 (DAEDAMDAMDGAVLDGR;VGDVYIPR) - - - - 3 IPI00005978.7, IPI00385786.3, IPI00796848.1
280 IPI00006025.1 Isoform 1 of Squamous cell carcinoma antigen recognized by T-cells 3 Cyto(SP); Nucl(SP) - 2.60E-02 (YKPYEEALLQAEAPR;EFESAIVEAAR;ALSSVGLHMTK;ALQRPSAAAPQAENGPAAAPAVAAPAATEAPK;HGVDHQVISVTFEK;RVENSIPAAGETQNVEVAAGPAGK) - - - - 1 IPI00006025.1
281 IPI00006034.1 Cysteine-rich protein 2 Cyto(G2) - - - 5.89E-02 (PCYGILFGPKGVNTGAVGSYIYDRDPEGK;GVNTGAVGSYIYDRDPEGK) 1.26E-01 (GVNIGGAGSYIYEKPLAEGPQVTGPIEVPAAR;GVNTGAVGSYIYDRDPEGK) - 1 IPI00006034.1
282 IPI00006038.4 Isoform 1 of Nuclear pore complex protein Nup98-Nup96 precursor Nucl(SP,GO); Cyto(GO) - 8.05E-03 (EEIENNSYHMHPAGIILTK;HCQLLETPESWAKETFLTQK) 2.00E-02 (HCQLLETPESWAKETFLTQK;LTTFGSSTTSAPSFGTTSGGLFGNK) - - 1.95E-01 (EVVVYLDDNQKPPVGEGLNR;NSPVEAVFSYLTGK;PAPGTLGTGLGAGFGTALGAGQASLFGNNQPK;PVDENHQQDGDEDSLVSHFYTNPIAK;FSFLSKPVDENHQQDGDEDSLVSHFYTNPIAK;HYDLNQLLEPR;IFALLAGKPVWQLSEK;LALLLSQFVGSQSVR;SSLIQDWETSGLVYLD 1 IPI00006038.4
283 IPI00006052.3 Prefoldin subunit 2 Cyto(G1) - 1.46E-01 (GAVSAEQVIAGFNR;IIETLTQQLQAK) - - - - 1 IPI00006052.3
284 IPI00006071.4 Isoform 1 of ADP-ribosyl cyclase 1 ER(G2) - - - - 3.73E-02 (IKDLAHQFTQVQR;VQTLEAWVIHGGR) - 1 IPI00006071.4
285 IPI00006079.1 Isoform 1 of Bcl-2-associated transcription factor 1 Cyto(SP); Nucl(SP,GO) - 1.09E-02 (LAGEERVFK;SSSPYSKSPVSK;RFTDEESRVFLLDR) - - - 9.12E-02 (FNDSEGDDTEETEDYR;LLASTLVHSVK;SSFYPDGGDQETAK;LKETGYVVERPSTTK) 3 IPI00006079.1, IPI00413671.1, IPI00413672.1
286 IPI00006089.1 Metabotropic glutamate receptor 6 precursor PM(SP,GO) 2.30E-02 (LMETPNARGIIIFANEDDIR;IYRIFEQGK) - - - - - 2 IPI00477414.1, IPI00006089.1
287 IPI00006091.2 Isoform 4 of Dystrophin Cyto(G2,SP,GO); PM(SP,GO) - 2.15E-03 (RQKLLEQSIQSAQETEK;EAALEETHR) - 6.07E-03 (WYLKELQDGIGQRQTVVR;NVMKNIMAGLQQTNSEKILLSWVR;DMNEDNEGTVK;EEWPALGDSEILK) 6.52E-03 (WYLKELQDGIGQRQTVVR;LVEPQISELNHR;LGLLLHDSIQIPR) - 3 IPI00006091.2, IPI00304639.2, IPI00472316.1
288 IPI00006092.1 Phosphomannomutase 2 Cyto(SP,GO) - 3.60E-01 (IGVVGGSDFEK;VQEQLGNDVVEK;VQEQLGNDVVEKYDYVFPENGLVAYK;YDYVFPENGLVAYK;QNIQSHLGEALIQDLINYCLSYIAK;YDYVFPENGLVAYKDGKLLCR) - - - - 1 IPI00006092.1
289 IPI00006096.1 Protein KIAA0586 Cyto(G2) - - 1.35E-02 (ETNSMVQPKESLSMLKLPDLPQNSVK;YNGPPFPPVASTFQPTADILDK;QIEEHFR) - - - 2 IPI00006096.1, IPI00413612.1
290 IPI00006113.1 DNA-directed RNA polymerase II subunit I Nucl(SP,GO) - - - - - 2.36E-01 (ITHEVDELTQIIADVSQDPTLPR;LYYVCTAPHCGHR) 1 IPI00006113.1
291 IPI00006114.4 Pigment epithelium-derived factor precursor ER(G1) - 7.00E-02 (EIPDEISILLLGVAHFK;LAAAVSNFGYDLYR;VRSSMSPTTNVLLSPLSVATALSALSLGAEQR;ELLDTVTAPQK;KTSLEDFYLDEER;LQSLFDSPDFSK) - - 3.54E-02 (EIPDEISILLLGVAHFK;LAAAVSNFGYDLYR) 8.39E-02 (EIPDEISILLLGVAHFK;LAAAVSNFGYDLYR;ALYYDLISSPDIHGTYK) 1 IPI00006114.4
292 IPI00006122.4 Isoform MEA6 of Cutaneous T-cell lymphoma-associated antigen 5 ER(G1) 1.93E-01 (DALNENSQLQESQK;EATEAQSLEATCEK;TIHSYQGQIISHEK;ISHATEELETYR) - - 6.29E-01 (AFLSPPTLLEGPLR;DALNENSQLQESQK;EYEGYEVESSLK;GPGNPLDHQITNER;HSEQDELMADISK;ISHATEELETYR;NLQTEQASLQSENTHFENENQK;NQIYIQLSEVDK;TIHSYQGQIISHEK;VMTELYQENEMK;FELLEKDPYALDVPNTAFGR;EHSPYGPSPLGWPSSETR) 2.13E-01 (DALNENSQLQESQK;HSEQDELMADISK;ISHATEELETYR;NQIYIQLSEVDK;VMTELYQENEMK;AFLSPPTLLEGPLR;TIHSYQGQIISHEK;VHAEQVLNDKESHIK) - 4 IPI00006122.4, IPI00401163.5, IPI00402229.4, IPI00515009.1
293 IPI00006143.2 KIAA0013 protein (Fragment) Nucl(G2) - - - 1.10E-02 (PVVNNNMGISSGINNR;MSWTGPNNSSFQEVDANEASSMVENLEVENSLEPDIMVEK) - - 2 IPI00006143.2, IPI00477330.2
294 IPI00006152.1 Isoform 1 of Sphingosine 1-phosphate receptor Edg-8 PM(SP,GO) - - - - 4.26E-02 (DGLDTSGSTGSPGAPTAAR;DLRHALLR) - 2 IPI00006152.1, IPI00179221.3
295 IPI00006165.1 C1orf13 Cyto(G2); Mito(MitoP2) - 3.06E-02 (ESQELAQHAAEIGADGIAVIAPFFLKPWTK;IRAEELLDGILDK) - - - - 3 IPI00006165.1, IPI00447505.1, IPI00470729.1
296 IPI00006167.1 Protein phosphatase 2C isoform gamma Nucl(G2,HPA) - 2.18E-02 (ALEDAFLAIDAK;ELAQIAGRPTEDEDEKEK) - - - - 1 IPI00006167.1
297 IPI00006176.3 Hepatocyte growth factor-regulated tyrosine kinase substrate Cyto(G2,SP,GO,HPA) - 3.02E-02 (ALQNAVTTFVNR;ILYLIQAWAHAFR;VCEPCYEQLNR) - 2.14E-02 (QGDTQAKYAVNSIK;ATSQLLLETDWESILQICDLIR) - - 1 IPI00006176.3
298 IPI00006181.1 Eukaryotic translation initiation factor 3 subunit 7 Nucl(G2); Cyto(GO) - 5.60E-02 (TQGNVFATDAILATLMSCTR;YSSQFGGGSQYAYFHEEDESSFQLVDTAR;HVILGTQQFKPNEFASQINLSVENAWGILR;WTCCALLAGSEYLK;LGDDIDLIVR) - - - - 1 IPI00006181.1
299 IPI00006205.1 Acetyl-coenzyme A transporter 1 ER(G1); PM(GO) - - - 6.37E-02 (EALLGDTGTGDFLK;EHLALLAVPMVPLQIILPLIISK) 1.54E-01 (EALLGDTGTGDFLK;EHLALLAVPMVPLQIILPLIISK) - 1 IPI00006205.1
300 IPI00006211.4 VAMP-associated protein B/C ER(G1,GO,HPA) 2.45E-01 (GPFTDVVTTNLK;SLSSSLDDTEVKK;TVQSNSPISALAPTGK) 4.32E-02 (GPFTDVVTTNLK;VEQVLSLEPQHELK;SLSSSLDDTEVKK) - 1.68E+00 (GPFTDVVTTNLK;FRGPFTDVVTTNLK;VEQVLSLEPQHELK;KTVQSNSPISALAPTGK;SLSSSLDDTEVK;SLSSSLDDTEVKK;TVQSNSPISALAPTGK) 1.82E+00 (GPFTDVVTTNLK;FRGPFTDVVTTNLK;VEQVLSLEPQHELK;SLSSSLDDTEVK;SLSSSLDDTEVKK;TVQSNSPISALAPTGK) 2.72E-01 (GPFTDVVTTNLK;VEQVLSLEPQHELK;SLSSSLDDTEVKK;TVQSNSPISALAPTGK) 1 IPI00006211.4
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home