Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
301 IPI00006213.2 Pericentriol material 1 Nucl(G2,GO,HPA); Cyto(SP,GO,HPA) - 7.51E-03 (KNHEQLEKIIK;QNSNNTRGNANKTQK) - 1.41E-02 (QNSNNTRGNANKTQK;LPEEEVESSRTPWLYEQEGEVEK;LTIYSEADLR;RQGLAETASPVAVSLR) 7.59E-03 (DPQQEPMEEIENLK;LTIYSEADLR) 9.00E-03 (TEYMAFPKPFESSSSIGAEKPR;QNSNNTRGNANKTQK) 2 IPI00006213.2, IPI00795923.1
302 IPI00006250.4 Isoform 1 of Short-chain dehydrogenase/reductase 3 ER(G1) 7.50E-02 (AAVGLVLPAK;FPNLFPPLKPETVAR) - - 6.55E-01 (AAVGLVLPAK;LGALVMFPLQMIYLVVK;FPNLFPPLKPETVAR;SILPQAALEEIHK;SLMDSDDDALLK;SQHINTLGQFWTTK;VGDITILVNNAAVVHGK;VRFPNLFPPLKPETVAR) 4.61E-01 (AAVGLVLPAK;LGALVMFPLQMIYLVVK;FPNLFPPLKPETVAR;SILPQAALEEIHK;SQHINTLGQFWTTK;VGDITILVNNAAVVHGK;TVEAVQLNQALLLLPWTMHALVILK;SLMDSDDDALLK) - 1 IPI00006250.4
303 IPI00006283.3 Isoform 2 of Serine/threonine-protein kinase TAO2 Nucl(G1,SP,GO,HPA); Cyto(SP,GO,HPA) - - - - - 1.52E-02 (GGALLLLRNSPQPLRR;FVLRERPPTVIMDLIQR) 1 IPI00006283.3
304 IPI00006379.1 Nucleolar protein NOP5 Nucl(SP,GO,HPA); Cyto(GO) 5.49E-02 (LGGVIKEK;EKLNLSCIHSPVVNELMRGIR) - - - - 2.39E-01 (IEQVDKEDEITEK;LSELLPEEVEAEVK;TYDPSGDSTLPTCSK;YGLIYHASLVGQTSPK;LIAHAGSLLNLAK;TQLYEYLQNR) 1 IPI00006379.1
305 IPI00006440.5 mitochondrial ribosomal protein S7 Cyto(G2); Mito(GO,MitoP2) - 2.55E-02 (YHAASAEEQATIER;KTQLIKAAPAGK) - 5.40E-02 (AAPAGKTSSVFEDPVISK;FTNMMMIGGNKVLAR) - - 1 IPI00006440.5
306 IPI00006442.1 Coilin Nucl(SP,GO) - - - - - 2.61E-02 (DYSLLPLLAAAPQVGEK;LEERGVAENSVVISNGDINLSLRK) 1 IPI00006442.1
307 IPI00006443.2 Lambda-crystallin homolog Cyto(G1) - 3.51E+00 (EVAGFVLNR;HVLQTFGPIPEFSR;IFAQLDSIIDDR;KIFAQLDSIIDDR;LFAGLVHVK;LYDIEQQQIR;QCIVAHPVNPPYYIPLVELVPHPETAPTTVDR;VPDDPEHLAAR;LQYAIISEAWR;LVEEGIVSPSDLDLVMSEGLGMR;LLEQAGSLK;VILSSSTSCLMPSK;SWAMLFASGGF - - 1.11E-01 (HVLQTFGPIPEFSR;LFAGLVHVK;LYDIEQQQIR) - 1 IPI00006443.2
308 IPI00006451.5 Vesicle-fusing ATPase Cyto(SP,GO,HPA) - 5.06E-02 (IDGVEQLNNILVIGMTNRPDLIDEALLRPGR;THPSVVPGSIAFSLPQR;VVNGPEILNK;FSNLVLQALLVLLK;GHQLLSADVDIK;VLDDGELLVQQTK;NFSGAELEGLVR;DFQSGQHVIVR;YVGESEANIR) - 4.29E-02 (IDGVEQLNNILVIGMTNRPDLIDEALLRPGR;FSNLVLQALLVLLK;LLDYVPIGPR;MGIGGLDKEFSDIFR;GHQLLSADVDIK) 7.48E-02 (GHQLLSADVDIK;MGIGGLDKEFSDIFR;WAGLSIGQEIEVSLYTFDK;AENSSLNLIGK;FSNLVLQALLVLLK;TPLVSVLLEGPPHSGK;VLDDGELLVQQTK) 1.82E-02 (FSNLVLQALLVLLK;NSDRTPLVSVLLEGPPHSGK) 1 IPI00006451.5
309 IPI00006482.1 Isoform Long of Sodium/potassium-transporting ATPase alpha-1 chain precursor PM(G1,SP,GO); Mito(MitoP2) 3.40E+00 (AVAGDASESALLK;AVFQANQENLPILK;DAFQNAYLELGGLGER;DGPNALTPPPTTPEWIK;EQPLDEELKDAFQNAYLELGGLGER;IVEIPFNSTNK;LSLDELHR;NIAFFSTNCVEGTAR;SPDFTNENPLETR;TSATWLALSR;VDNSSLTGESEPQTR;MSINAEEVVVGDLVEVK;GVGI - 5.69E-02 (GVGIISEGNETVEDIAAR;VDNSSLTGESEPQTR) 5.65E-02 (GVGIISEGNETVEDIAAR;LNIPVSQVNPR;VDNSSLTGESEPQTR;SPDFTNENPLETR;AVFQANQENLPILK) 7.96E-01 (ADIGVAMGIAGSDVSK;GVGIISEGNETVEDIAAR;KADIGVAMGIAGSDVSK;QGAIVAVTGDGVNDSPALK;VDNSSLTGESEPQTR;LNIPVSQVNPR;AVAGDASESALLK;AVFQANQENLPILK;DGPNALTPPPTTPEWIK;EQPLDEELKDAFQNAYLELGGLGER;IVEIPFNSTNK;MSI 1.59E+00 (DAFQNAYLELGGLGER;EQPLDEELKDAFQNAYLELGGLGER;IVEIPFNSTNK;VDNSSLTGESEPQTR;AVAGDASESALLK;AVFQANQENLPILK;DGPNALTPPPTTPEWIK;NIAFFSTNCVEGTAR;SPDFTNENPLETR;TSATWLALSR;LSLDELHR;GVGIISEGNETVEDIAAR;LNI 1 IPI00006482.1
310 IPI00006504.3 Isoform 1 of Translation initiation factor eIF-2B subunit gamma Cyto(G2,GO) - 3.82E-02 (HLVGVDSLIGPETQIGEK;FHTGLVDAHLYCLK;MEFQAVVMAVGGGSR) - - - - 3 IPI00006504.3, IPI00217227.3, IPI00332950.5
311 IPI00006547.4 T-cell immunomodulatory protein precursor PM(G2) - - - - 6.26E-02 (NNFEADAYFVK;SANFLDHLYVGIPR;NDLIVFLADQNAPYFKPK) - 1 IPI00006547.4
312 IPI00006579.1 Cytochrome c oxidase subunit 4 isoform 1, mitochondrial precursor PM(G1); Nucl(GO,HPA); Mito(SP,GO,MitoP2,HPA) 1.19E+01 (DHPLPEVAHVK;SEDFSLPAYMDR;ASWSSLSMDEK;RDHPLPEVAHVK;HYVYGPLPQSFDK;HYVYGPLPQSFDKEWVAK;VNPIQGLASK) - 5.09E-01 (HYVYGPLPQSFDK;HYVYGPLPQSFDKEWVAK;VNPIQGLASK) 1.72E-01 (HYVYGPLPQSFDK;SEDFSLPAYMDR;SEDFSLPAYMDRR;FKESFAEMNR) 7.98E-01 (FKESFAEMNR;HYVYGPLPQSFDK;SEDFSLPAYMDR;VNPIQGLASK) 5.82E-01 (HYVYGPLPQSFDK;VFSLVGKRAISTSVCVR;HYVYGPLPQSFDKEWVAK) 1 IPI00006579.1
313 IPI00006592.1 Peptide methionine sulfoxide reductase Cyto(G1) - 4.59E-01 (GVYSTQVGFAGGYTSNPTYK;NPNGYCGLGGTGVSCPVGIK;VLSEHGFGPITTDIR;EGQTFYYAEDYHQQYLSK;VVYQPEHMSFEELLK) 1.63E-01 (GVYSTQVGFAGGYTSNPTYK;VLSEHGFGPITTDIR;EGQTFYYAEDYHQQYLSK) - - - 2 IPI00006592.1, IPI00796388.1
314 IPI00006610.1 Zinc finger BED domain-containing protein 4 Cyto(SP,GO); Nucl(SP,GO) - - 1.11E-02 (HPEVVGSQKGFLGASLANSPYATLASAESSSSK;ASLFTEEEAEQYKQDLIRELELMNSTSEDVAASHR) - - - 1 IPI00006610.1
315 IPI00006662.1 Apolipoprotein D precursor Cyto(G1) 2.93E-01 (CPNPPVQENFDVNK;NILTSNNIDVK) 2.81E-01 (CPNPPVQENFDVNK;NILTSNNIDVK;IPTTFENGR) - 2.65E-01 (NILTSNNIDVK;NPNLPPETVDSLK) 1.90E-01 (NILTSNNIDVK;NPNLPPETVDSLK) - 1 IPI00006662.1
316 IPI00006663.1 Aldehyde dehydrogenase, mitochondrial precursor Mito(SP,GO,MitoP2) 6.25E+00 (AAFQLGSPWR;ANNSTYGLAAAVFTK;EAGFPPGVVNIVPGFGPTAGAAIASHEDVDK;EEIFGPVMQILK;ELGEYGLQAYTEVK;GYFIQPTVFGDVQDGMTIAK;HEPVGVCGQIIPWNFPLLMQAWK;LGPALATGNVVVMK;LLCGGGIAADR;TEQGPQVDETQFK;TFVQEDIYDEFVER;TI 5.10E+00 (DLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYK;EEIFGPVMQILK;ANNSTYGLAAAVFTK;EAGFPPGVVNIVPGFGPTAGAAIASHEDVDK;EAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGR;ILGYINTGK;KILGYINTGK;LGPALATGNVVVMK;LLCGGGIAADR;TE 1.22E+02 (ANYLSQALQAGTVWVNCYDVFGAQSPFGGYK;DLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYK;EEIFGPVMQILK;ANNSTYGLAAAVFTK;FKTIEEVVGR;EAGFPPGVVNIVPGFGPTAGAAIASHEDVDK;EAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGR;ILGYINT 2.98E-01 (ANNSTYGLAAAVFTK;EEIFGPVMQILK;ELGEYGLQAYTEVK;GYFIQPTVFGDVQDGMTIAK;TEQGPQVDETQFK;TFVQEDIYDEFVER;VAEQTPLTALYVANLIK;VAFTGSTEIGR) 1.81E-01 (GYFIQPTVFGDVQDGMTIAK;TFVQEDIYDEFVER;VAEQTPLTALYVANLIK;ANNSTYGLAAAVFTK;TIPIDGDFFSYTR;EEIFGPVMQILK;VAFTGSTEIGR;EAGFPPGVVNIVPGFGPTAGAAIASHEDVDK) 5.57E+00 (DLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYK;EEIFGPVMQILK;ANNSTYGLAAAVFTK;ANYLSQALQAGTVWVNCYDVFGAQSPFGGYK;EAGFPPGVVNIVPGFGPTAGAAIASHEDVDK;KILGYINTGK;LLCGGGIAADR;TEQGPQVDETQFK;TIPIDGDFFSYTR;VAEQTPLTAL 1 IPI00006663.1
317 IPI00006674.1 Isoform 3 of Canalicular multispecific organic anion transporter 2 PM(G1,GO) 5.62E-02 (AVYSDADIFLLDDPLSAVDSHVAK;ILVLDEATAAIDLETDNLIQATIR;SQLTIIPQDPILFSGTLR) - - - 1.21E-02 (ADGALTQEEKAAIGTVELSVFWDYAK;QLSALSSDGEGQGR) 1.44E-02 (HIFDHVIGPEGVLAGK;IQQFLSQEELDPQSVER) 1 IPI00006674.1
318 IPI00006684.3 Isoform 4 of Apoptosis inhibitor 5 Cyto(G1,SP); Nucl(G1,SP,GO,HPA) - 1.55E-02 (GTLGGLFSQILQGEDIVR;NYGILADATEQVGQHK) - - - 5.98E-01 (GTLGGLFSQILQGEDIVR;LQFSYVECLLYSFHQLGR;NYGILADATEQVGQHK;ELPQFATGENLPR;VADILTQLLQTDDSAEFNLVNNALLSIFK;STVTLSWKPVQK) 3 IPI00006684.3, IPI00554742.1, IPI00555572.1
319 IPI00006707.1 Isoform 1 of Pulmonary surfactant-associated protein C precursor Mito(G1) - - 1.01E-01 (EVLMESPPDYSAAPR;LLIVVVVVVLIVVVIVGALLMGLHMSQK) - - - 3 IPI00006707.1, IPI00218499.1, IPI00792510.1
320 IPI00006713.1 Isoform 1 of DnaJ homolog subfamily C member 3 ER(G1) - - - 2.66E-01 (AEAYLIEEMYDEAIQDYETAQEHNENDQQIR;KKFDDGEDPLDAESQQGGGGNPFHR;ISTLYYQLGDHELSLSEVR;KFDDGEDPLDAESQQGGGGNPFHR;LIESAEELIR;LLAAGQLADALSQFHAAVDGDPDNYIAYYR;SNPSENEEKEAQSQLIK;SQALNAFGSGDYTAAIAFLDK;SWNSW 1.32E-01 (LLAAGQLADALSQFHAAVDGDPDNYIAYYR;SNPSENEEKEAQSQLIK;SQALNAFGSGDYTAAIAFLDK;TEPSIAEYTVR;ISTLYYQLGDHELSLSEVR) - 1 IPI00006713.1
321 IPI00006715.3 Double-strand-break repair protein rad21 homolog Nucl(G1,SP,GO,HPA) - - - - - 1.42E+00 (AHVFECNLESSVESIISPK;EFENPEVPREDQQQQHQQR;GGEADNLDEFLK;GGEADNLDEFLKEFENPEVPR;INHLEYEDQYKDDNFGEGNDGGILDDK;LFSLPAQPLWNNR;QQAIELTQEEPYSDIIATPGPR;TGAESISLLELCR;YLLADCNEAFIK;AQLSDYSDIVTTLDLAPPTK;AQ 1 IPI00006715.3
322 IPI00006723.4 WD repeat protein 57 Nucl(G1) - - - - - 8.84E-01 (GHTSFVNSCYPAR;IFQGNVHNFEK;FVYVWDTTSR;VWDVRPFAPK;LPGHAGSINEVAFHPDEPIIISASSDK;LPGHAGSINEVAFHPDEPIIISASSDKR;KAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIK;HELLLGAGSGPGAGQQQATPGALLQAGPPR;AAIQTFQNTYQVLAVTFN 1 IPI00006723.4
323 IPI00006725.1 Probable ATP-dependent RNA helicase DDX23 Nucl(SP,GO,HPA); Mito(HPA); PM(HPA) - - - - - 3.94E-02 (LLAILEQGFDPPIIIFVNQK;IEESDQGPYAIILAPTR) 1 IPI00006725.1
324 IPI00006742.1 Isoform Alpha of Glycogenin-2 Cyto(G1,GO) - 1.49E-01 (LHCWTLTHYSK;LLLQHAMEHGSFDGADQGLLNSFFR;LVVLITPQVSSLLR;KLVVLITPQVSSLLR;CVFLDADTLVLSNVDELFDR) - - - - 6 IPI00006742.1, IPI00218983.1, IPI00218984.1, IPI00218985.1, IPI00218986.1, IPI00292838.4
325 IPI00006754.1 WD repeat protein 68 Nucl(G1,SP,GO,HPA); Cyto(SP,GO,HPA) - - - - - 6.19E-02 (GVYPDLLATSGDYLR;HLEHSTIIYEDPQHHPLLR) 1 IPI00006754.1
326 IPI00006865.2 Vesicle-trafficking protein SEC22b ER(G1) 3.22E-01 (NLGSINTELQDVQR;PYSFIEFDTFIQK;IMVANIEEVLQR) - 5.20E-02 (NLGSINTELQDVQR;PYSFIEFDTFIQK) 3.92E+00 (VPTVSRPYSFIEFDTFIQK;IMVANIEEVLQR;KLAFAYLEDLHSEFDEQHGK;KVPTVSRPYSFIEFDTFIQK;LAFAYLEDLHSEFDEQHGK;NLGSINTELQDVQR;PYSFIEFDTFIQK;VADGLPLAASMQEDEQSGR;VLLTMIAR;RNLGSINTELQDVQR;DLQQYQSQAK) 3.07E+00 (VPTVSRPYSFIEFDTFIQK;IMVANIEEVLQR;KLAFAYLEDLHSEFDEQHGK;KVPTVSRPYSFIEFDTFIQK;LAFAYLEDLHSEFDEQHGK;NLGSINTELQDVQR;PYSFIEFDTFIQK;RNLGSINTELQDVQR;VADGLPLAASMQEDEQSGR;VLLTMIAR;DLQQYQSQAK) 5.30E-01 (KLAFAYLEDLHSEFDEQHGK;LAFAYLEDLHSEFDEQHGK;VPTVSRPYSFIEFDTFIQK;NLGSINTELQDVQR;PYSFIEFDTFIQK) 1 IPI00006865.2
327 IPI00006920.2 HRAS-like suppressor Cyto(G2) - - - - 5.80E-02 (ETPGHTQLPPGAR;AISTVEFVTAAVGVFSFLGLFPKGQR) - 1 IPI00006920.2
328 IPI00006932.2 Isoform 1 of Putative RNA-binding protein Luc7-like 2 Nucl(G1) - 1.99E-02 (VEQLGAEGNVEESQK;LHLGFIEIR) - - 1.66E-01 (VEQLGAEGNVEESQK;EEIEKLR) 7.71E-01 (SHLLNCCPHDVLSGTR;VEQLGAEGNVEESQK) 2 IPI00006932.2, IPI00216804.1
329 IPI00006934.1 Hydroxyacid oxidase 1 Cyto(G1) 8.44E-01 (AIFVTVDTPYLGNR;GVQDVLEILKEEFR;NVAETDLSTSVLGQR;QLDGVPATIDVLPEIVEAVEGK;SGANDEETLADNIAAFSR) 1.75E+00 (AIDPSISWEDIK;AIFVTVDTPYLGNR;AVFVGRPIVWGLAFQGEK;GVQDVLEILKEEFR;HGLNGILVSNHGAR;NFETSTLSFSPEENFGDDSGLAAYVAK;LAMALSGCQNVK;LICINDYEQHAK;MAHVDGELATVR;NVAETDLSTSVLGQR;PIVWGLAFQGEK;QLDGVPATIDVLPEIVE 1.45E-01 (GVQDVLEILKEEFR;HGLNGILVSNHGAR) 2.16E-01 (AIFVTVDTPYLGNR;GVQDVLEILKEEFR;NVAETDLSTSVLGQR;QLDGVPATIDVLPEIVEAVEGK) 3.31E-02 (GVQDVLEILKEEFR;ALALGAKAVFVGR) 2.55E-01 (AIFVTVDTPYLGNR;GVQDVLEILKEEFR;NVAETDLSTSVLGQR;QLDGVPATIDVLPEIVEAVEGK;SGANDEETLADNIAAFSR;GILRGDDAR) 1 IPI00006934.1
330 IPI00006935.2 Eukaryotic translation initiation factor 5A-2 Cyto(G2,GO) - 4.92E-02 (HGHAKVHLVGIDIFTGK;VHLVGIDIFTGK;VHLVGIDIFTGKK;ADEIDFTTGDAGASSTYPMQCSALR) - - - - 1 IPI00006935.2
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home