Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
331 IPI00006937.2 Ubiquitin-conjugating enzyme E2 J1 ER(SP) - - - 1.16E-01 (TALLAIIGFMPTK;GPPDSDFDGGVYHGR) - - 1 IPI00006937.2
332 IPI00006952.3 Lactamase, beta 2 variant Cyto(G1) - 3.13E-01 (ADIIYPGHGPVIHNAEAK;IKADIIYPGHGPVIHNAEAK;SINNDTTYCIK;EEIIGNGEQQYVYLK;ILIDTGEPAIPEYISCLK;NPQREEIIGNGEQQYVYLK;EQQILTLFR) 6.21E-02 (EEIIGNGEQQYVYLK;ADIIYPGHGPVIHNAEAK) - - - 1 IPI00006952.3
333 IPI00006957.3 Isoform 1 of Dehydrogenase/reductase SDR family member 7 precursor ER(G1) 7.01E-01 (ADGDLTLLWAEWQGR;AVLQEFGR;IVTVNSILGIISVPLSIGYCASK;LGVSLVLSAR;LIELNYLGTVSLTK;LMLISMANDLK;DILVLPLDLTDTGSHEAATK;EKDILVLPLDLTDTGSHEAATK;SGVDADSSYFK;TELATYPGIIVSNICPGPVQSNIVENSLAGEVTK) - - 3.32E+00 (AVLQEFGR;IDILVNNGGMSQR;KLIELNYLGTVSLTK;LGVSLVLSAR;LIELNYLGTVSLTK;LMLISMANDLK;RPEWELTDMVVWVTGASSGIGEELAYQLSK;GFFNGLR;DILVLPLDLTDTGSHEAATK;EKDILVLPLDLTDTGSHEAATK;SGVDADSSYFK) 5.04E+00 (AVLQEFGR;IDILVNNGGMSQR;KLIELNYLGTVSLTK;LGVSLVLSAR;LIELNYLGTVSLTK;LMLISMANDLK;GFFNGLR;ADGDLTLLWAEWQGR;DILVLPLDLTDTGSHEAATK;EKDILVLPLDLTDTGSHEAATK;SGVDADSSYFK) - 1 IPI00006957.3
334 IPI00006970.2 Ribosomal protein S2, bacterial and organelle form family protein Mito(SP,MitoP2) - - 6.62E-02 (LPDLIIFLHTLNNIFEPHVAVR;VPAMATSSAALPR) - - - 1 IPI00006970.2
335 IPI00006980.1 Protein C14orf166 Cyto(G1,SP); Nucl(SP,HPA) - 2.53E-01 (HILGFDTGDAVLNEAAQILR;INEAIVAVQAIIADPK;NAEPLINLDVNNPDFK;KLTALDYHNPAGFNCK;KLTALDYHNPAGFNCKDETEFR;ILVQERLTQDAVAKANQTK;LLHIEELR;NFIVWLEDQK) 5.58E-02 (HILGFDTGDAVLNEAAQILR;NAEPLINLDVNNPDFK) 5.16E-01 (AGVMALANLLQIQR;HDDYLVMLK;HILGFDTGDAVLNEAAQILR;INEAIVAVQAIIADPK;NAEPLINLDVNNPDFK;EGLPVALDK;LLHIEELR) 2.13E-01 (HILGFDTGDAVLNEAAQILR;INEAIVAVQAIIADPK;NAEPLINLDVNNPDFK;EGLPVALDK) 5.56E-01 (HILGFDTGDAVLNEAAQILR;INEAIVAVQAIIADPK;LTALDYHNPAGFNCK;NAEPLINLDVNNPDFK;KLTALDYHNPAGFNCK;LLHIEELR;EGLPVALDK) 2 IPI00006980.1, IPI00792100.1
336 IPI00007047.1 Protein S100-A8 Nucl(G1); Cyto(G1,SP); PM(SP) - 8.94E-01 (ALNSIIDVYHK;ELDINTDGAVNFQEFLILVIK;KLLETECPQYIR;LLETECPQYIR) - 1.46E-01 (ALNSIIDVYHK;ELDINTDGAVNFQEFLILVIK) 2.61E-01 (ALNSIIDVYHK;ELDINTDGAVNFQEFLILVIK) 7.42E-01 (ALNSIIDVYHK;KLLETECPQYIR;LLETECPQYIR) 1 IPI00007047.1
337 IPI00007052.6 Mitochondrial fission 1 protein PM(G1); Mito(SP,GO,MitoP2,HPA) 1.33E+01 (DYVFYLAVGNYR;GIVLLEELLPK;GLLQTEPQNNQAK;KGIVLLEELLPK;STQFEYAWCLVR) 2.37E-01 (GLLQTEPQNNQAK;DYVFYLAVGNYR) 1.57E-01 (GIVLLEELLPK;DGLVGMAIVGGMALGVAGLAGLIGLAVSKSK;STQFEYAWCLVR;DYVFYLAVGNYR) 6.37E-01 (GLLQTEPQNNQAK;GIVLLEELLPK) 3.45E+00 (DYVFYLAVGNYR;GIVLLEELLPK;GLLQTEPQNNQAK;KGIVLLEELLPK) 1.66E+00 (GIVLLEELLPK;STQFEYAWCLVR;GLLQTEPQNNQAK;KGIVLLEELLPK) 1 IPI00007052.6
338 IPI00007058.1 Coronin-1B Cyto(G1,SP) - 1.15E-01 (KSDLFQDDLYPDTAGPEAALEAEEWVSGR;YFEITEEPPYIHFLNTFTSK;VFTTGFSR;DADPILISLR) - - - - 1 IPI00007058.1
339 IPI00007060.1 Peptide deformylase, mitochondrial precursor Mito(G2,GO,MitoP2) - - - - 6.14E-02 (RCVGLSAPQLGVPR;HLRRLVLGPPEPPFSHVCQVGDPVLR) - 1 IPI00007060.1
340 IPI00007061.1 Vesicle transport protein GOT1B ER(G1,GO) - - - 3.64E-01 (VPVLGSLLNLPGIR;RVPVLGSLLNLPGIR) - - 2 IPI00007061.1, IPI00791523.1
341 IPI00007063.5 Hepatoma-derived growth factor-related protein 3 Nucl(SP,GO) - - - - - 2.18E-01 (YPIFFFGTHETAFLGPK;IDELPEGAVKPPANK;DCKEEENKSSSEGGDAGNDTR) 1 IPI00007063.5
342 IPI00007067.4 Golgi-associated plant pathogenesis-related protein 1 ER(G1) - - - 6.70E-02 (EAQQYSEALASTR;ASASDGSSFVVAR) 5.76E-01 (ASASDGSSFVVAR;EAQQYSEALASTR) - 2 IPI00007067.4, IPI00479010.1
343 IPI00007074.4 Tyrosyl-tRNA synthetase, cytoplasmic Cyto(SP,GO,HPA); Nucl(GO) - 1.48E-01 (DFAAEVVHPGDLK;HPDADSLYVEK;ISEECIAQWK;TYTAYVDLEKDFAAEVVHPGDLK;VDAQFGGIDQR;LVVVLCNLKPQK;QVEPLDPPAGSAPGEHVFVK;TVVSGLVQFVPK;AGCEVTILFADLHAYLDNMK;NSEPEEVIPSR;HVLFPLK) 1.70E-02 (GYEKGQPDEELK;TVVSGLVQFVPK) - - 4.63E-02 (LVVVLCNLKPQK;TVVSGLVQFVPK) 1 IPI00007074.4
344 IPI00007084.2 Mitochondrial aspartate-glutamate carrier protein Mito(G1,SP,GO,MitoP2,HPA) 1.41E+01 (AGQTTYSGVIDCFR;GLIPQLIGVAPEK;LQVAGEITTGPR;LTVNDFVR;YEGFFGLYR;ASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIK;ASGDSARPVLLQVAESAYR;DIPFSAIYFPCYAHVK;DLGFFGIYK;DVEVTKEEFVLAAQK;FGLGSVAGAVGATAVYPIDLVK;FGLYL - 5.77E+00 (ASGDSARPVLLQVAESAYR;DVEVTKEEFVLAAQK;FGLYLPLFK;FGLYLPLFKPSVSTSK;FGQVTPMEVDILFQLADLYEPR;LAVATFAGIENK;LTVNDFVR;QVFGQTTIHQHIPFNWDSEFVQLHFGK;TVELLSGVVDQTK;AGQTTYSGVIDCFR;DIPFSAIYFPCYAHVK;DLGFFGIY 5.10E-01 (ASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIK;ASGDSARPVLLQVAESAYR;DVEVTKEEFVLAAQK;FGLGSVAGAVGATAVYPIDLVK;FGQVTPMEVDILFQLADLYEPR;GLIPQLIGVAPEK;HLTYAEFTQFLLEIQLEHAK;IAPLEEGTLPFNLAEAQR;INLPAPNPDHVGGYK; 8.75E-01 (ASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIK;ASGDSARPVLLQVAESAYR;DLGFFGIYK;FGLGSVAGAVGATAVYPIDLVK;FGQVTPMEVDILFQLADLYEPR;GEVTFEDVK;GLIPQLIGVAPEK;HLTYAEFTQFLLEIQLEHAK;IAPLEEGTLPFNLAEAQR;INLPAPNPDHVG 4.00E-01 (DVEVTKEEFVLAAQK;LAVATFAGIENK;DIPFSAIYFPCYAHVK;FGLGSVAGAVGATAVYPIDLVK;HLTYAEFTQFLLEIQLEHAK;IAPLEEGTLPFNLAEAQR;PVLLQVAESAYR;SSPQFGVTLLTYELLQR;YLNIFGESQPNPK;AGQTTYSGVIDCFR) 1 IPI00007084.2
345 IPI00007093.1 Hypothetical protein Cyto(G2) - 2.58E-02 (NEGRNEAHVLNGINDRGGQK;LLILLRGLPGSGKTTLSR) - - - - 1 IPI00007093.1
346 IPI00007117.1 Plasminogen activator inhibitor 2 precursor Cyto(G2,SP,GO,HPA); PM(GO) - - 3.14E-02 (KLNGLYPFR;SMGMEDAFNK) - - - 1 IPI00007117.1
347 IPI00007122.6 Chromosome 6 open reading frame 84 Cyto(G2,SP,GO,HPA); PM(GO,HPA); Nucl(SP,GO,HPA) - 1.09E-02 (DVLHSSKGNANSFPGTLDSK;NLEAEIDVLK) - - - - 1 IPI00007122.6
348 IPI00007123.1 Ribosomal protein S6 kinase alpha-6 Cyto(G2,GO); Nucl(GO) - 2.32E-02 (DILVEVNHPFIVK;IGNGKFSLSGGNWDNISDGAK;NETMNMILKAK) - - - - 1 IPI00007123.1
349 IPI00007127.3 Isoform 1 of Dipeptidase 2 precursor Nucl(G1); PM(GO) - - - - - 3.54E-02 (QRQSLTSGQELTEIPIHWTAKLPAK;RALEVSQAPVIFSHSAAR) 2 IPI00007127.3, IPI00290954.2
350 IPI00007188.4 ADP/ATP translocase 2 Mito(SP,GO,MitoP2); PM(GO) 2.06E+00 (AAYFGIYDTAK;DFLAGGVAAAISK;EQGVLSFWR;YFAGNLASGGAAGATSLCFVYPLDFAR;YFPTQALNFAFK;GAWSNVLR) - 5.80E+00 (EQGVLSFWR;QIFLGGVDK;YFAGNLASGGAAGATSLCFVYPLDFAR;YFPTQALNFAFK;LLLQVQHASK;GLYQGFNVSVQGIIIYR;GMGGAFVLVLYDEIK;GMGGAFVLVLYDEIKK;GAWSNVLR;DFLAGGVAAAISK;QIFLGGVDKR;GTDIMYTGTLDCWR;AAYFGIYDTAK) 1.68E-01 (YFPTQALNFAFK;DKYKQIFLGGVDK;EQGVLSFWR;VKLLLQVQHASK;DFLAGGVAAAISK;GMGGAFVLVLYDEIKK;AAYFGIYDTAK) 3.43E-01 (AAYFGIYDTAK;DFLAGGVAAAISK;GMGGAFVLVLYDEIK;GMGGAFVLVLYDEIKK;YFPTQALNFAFK;EQGVLSFWR) 8.71E-02 (AAYFGIYDTAK;YFPTQALNFAFK;YFAGNLASGGAAGATSLCFVYPLDFAR) 1 IPI00007188.4
351 IPI00007211.3 Isoform 1 of Protein KIAA0831 Nucl(G2); Cyto(SP); ER(SP) - - - 2.95E-02 (PLARDLVDSVDDAEGLYVAVERCPLCNTTR;EVLKAMEGKWITDQLR) - - 2 IPI00007211.3, IPI00784386.1
352 IPI00007219.1 Cytochrome P450 2C9 ER(SP,GO) 4.73E+00 (YALLLLLK;YIDLIPTSLPHAVTCDIK;DQQFLNLMEK;EALIDLGEEFSGR;EKHNQPSEFTIESLENTAVDLFGAGTETTSTTLR;FDYKDQQFLNLMEK;GFGIVFSNGK;GKLPPGPTPLPVIGNILQIGIK;GTTILISLTSVLHDNK;HNQPSEFTIESLENTAVDLFGAGTETTSTTLR;ILS 1.12E-01 (EKHNQPSEFTIESLENTAVDLFGAGTETTSTTLR;GTTILISLTSVLHDNK;HNQPSEFTIESLENTAVDLFGAGTETTSTTLR;LPPGPTPLPVIGNILQIGIK;VYGPVFTLYFGLKPIVVLHGYEAVK;GKLPPGPTPLPVIGNILQIGIK;ILSSPWIQICNNFSPIIDYFPGTHNK;YIDLIPTS 4.10E-01 (EKHNQPSEFTIESLENTAVDLFGAGTETTSTTLR;GTTILISLTSVLHDNK;ILSSPWIQICNNFSPIIDYFPGTHNK;LPPGPTPLPVIGNILQIGIK;GKLPPGPTPLPVIGNILQIGIK;GIFPLAER;GFGIVFSNGK;ASPCDPTFILGCAPCNVICSIIFHK) 1.21E+01 (HNQPSEFTIESLENTAVDLFGAGTETTSTTLR;DQQFLNLMEK;EALIDLGEEFSGR;EFPNPEMFDPHHFLDEGGNFK;EKHNQPSEFTIESLENTAVDLFGAGTETTSTTLR;FDYKDQQFLNLMEK;FSLMTLR;GFGIVFSNGK;GKLPPGPTPLPVIGNILQIGIK;GKLPPGPTPLPVIGNILQ 1.14E+01 (PIVVLHGYEAVK;VQEEARCLVEELR;DQQFLNLMEK;EALIDLGEEFSGR;FDYKDQQFLNLMEK;GFGIVFSNGK;RFSLMTLR;YALLLLLK;YALLLLLKHPEVTAK;FSLMTLR;EFPNPEMFDPHHFLDEGGNFK;EKHNQPSEFTIESLENTAVDLFGAGTETTSTTLR;GKLPPGPTPLPVI 9.44E-01 (EALIDLGEEFSGR;YALLLLLK;YIDLIPTSLPHAVTCDIK;EKHNQPSEFTIESLENTAVDLFGAGTETTSTTLR;GTTILISLTSVLHDNK;HNQPSEFTIESLENTAVDLFGAGTETTSTTLR;ILSSPWIQICNNFSPIIDYFPGTHNK;LPPGPTPLPVIGNILQIGIK;GFGIVFSNGKK;GKL 1 IPI00007219.1
353 IPI00007247.3 Propionyl-CoA carboxylase beta chain, mitochondrial precursor Mito(SP,GO,MitoP2) - 1.70E-01 (AYNMVDIIHSVVDER;SVTNEDVTQEELGGAK;VASGCLDINSSVK;AFENDVDALCNLR;IQEGVESLAGYADIFLR;LVPELDTIVPLESTK;GHENVEAAQAEYIEK) 5.81E-01 (AYNMVDIIHSVVDER;DTSYLFITGPDVVK;SVTNEDVTQEELGGAK;VASGCLDINSSVK;AFENDVDALCNLR;IQEGVESLAGYADIFLR;LVPELDTIVPLESTK;FPGDSVVTGR;GHENVEAAQAEYIEK;LLYAFAEATVPK;FCDAFNIPLITFVDVPGFLPGTAQEYGGIIR) - - 9.73E-02 (GHENVEAAQAEYIEK;SVTNEDVTQEELGGAK;IQEGVESLAGYADIFLR;LVPELDTIVPLESTK) 1 IPI00007247.3
354 IPI00007282.1 Cytochrome P450 2E1 ER(SP,GO) 9.32E-01 (RFSLTTLR;FSLTTLR;DIDLSPIHIGFGCIPPR;EAHFLLEALR;EALLDYKDEFSGR;FGPVFTLYVGSQR;FITLVPSNLPHEATR;FKPEHFLNENGK;GIIFNNGPTWK;GTVVVPTLDSVLYDNQEFPDPEK;YSDYFKPFSTGK;QEMPYMDAVVHEIQR) 1.58E-02 (FGPVFTLYVGSQR;FITLVPSNLPHEATR) 8.37E-02 (FGPVFTLYVGSQR;FITLVPSNLPHEATR) 7.35E+00 (RFSLTTLR;FSLTTLR;DRQEMPYMDAVVHEIQR;EAHFLLEALR;EAHFLLEALRK;EALLDYKDEFSGR;FGPVFTLYVGSQR;FITLVPSNLPHEATR;FKPEHFLNENGK;GIIFNNGPTWK;GTVVVPTLDSVLYDNQEFPDPEK;LYTMDGITVTVADLFFAGTETTSTTLR;QEMPYMDAVVH 5.19E+00 (RFSLTTLR;FSLTTLR;DRQEMPYMDAVVHEIQR;EAHFLLEALR;EAHFLLEALRK;EALLDYKDEFSGR;FGPVFTLYVGSQR;FITLVPSNLPHEATR;FKPEHFLNENGK;GTVVVPTLDSVLYDNQEFPDPEK;LYTMDGITVTVADLFFAGTETTSTTLR;QEMPYMDAVVHEIQR;QVHSSWN 2.56E-01 (EALLDYKDEFSGR;GTVVVPTLDSVLYDNQEFPDPEK;FGPVFTLYVGSQR;FITLVPSNLPHEATR;FGPVFTLYVGSQRMVVMHGYKAVK;EAHFLLEALR) 1 IPI00007282.1
355 IPI00007283.1 DNA-directed RNA polymerase II 16 kDa polypeptide Nucl(SP,GO) - - - - - 5.92E-01 (AGDVEEDASQLIFPK;FEDEELQQILDDIQTK) 1 IPI00007283.1
356 IPI00007293.4 centrosomal protein 164kDa Nucl(G2,SP,HPA); Cyto(SP,GO,HPA) - - - 7.81E-03 (EPQLSDSIASDPK;ASEKEAPEDTVDAGEEGSR) - - 2 IPI00007293.4, IPI00445310.1
357 IPI00007317.4 KIAA1018 protein Nucl(G2,SP,GO) - - 1.15E-02 (SLIDNSSEIEDEDQILENSSQK;TFHLVNPNGQKQQLVDAFLK) - - - 2 IPI00007317.4, IPI00793895.1
358 IPI00007321.1 Isoform 1 of Acyl-protein thioesterase 1 Cyto(G1,GO) - 1.07E+00 (ATAAVIFLHGLGDTGHGWAEAFAGIR;LAGVTALSCWLPLR;TLVNPANVTFK;ASFPQGPIGGANR;IILGGFSQGGALSLYTALTTQQK;KATAAVIFLHGLGDTGHGWAEAFAGIR;LLPPID) - - - 1.37E-01 (KATAAVIFLHGLGDTGHGWAEAFAGIR;ATAAVIFLHGLGDTGHGWAEAFAGIR) 2 IPI00007321.1, IPI00398727.3
359 IPI00007334.1 Isoform 1 of Apoptotic chromatin condensation inducer in the nucleus Nucl(SP,GO,HPA); Cyto(GO,HPA) - - - - - 3.26E-01 (AAPCIYWLPLTDSQIVQK;TEEQGIPRPLHPPPPPPVQPPQHPR;ISNIVHISNLVR;ISNIVHISNLVRPFTLGQLK;KPSISITTESLK;SGVSITIDDPVR;SHCFVTYSTVEEAVATR;SLIPDIKPLAGQEAVVDLHADDSR;TGTLVEEAFWIDK;TVTQVVPAEGQENGQR;LSEGSQPAEEE 1 IPI00007334.1
360 IPI00007364.1 Claudin-3 PM(G1,GO) 1.34E+00 (DFYNPVVPEAQK;STGPGASLGTGYDR;VYDSLLALPQDLQAAR) - - 1.08E-01 (VYDSLLALPQDLQAAR;DFYNPVVPEAQK) - - 1 IPI00007364.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home