Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
391 IPI00007919.1 Isoform 2 of Sterile alpha and TIR motif-containing protein 1 Nucl(G2) - - 1.47E-02 (AAGAAAGLVRAEAGGR;HSEETCQRLVAAGGLDAVLYWCR) - - - 1 IPI00007919.1
392 IPI00007926.1 c-Myc-responsive protein Rcl Cyto(G1,SP,GO); Nucl(GO) - 1.79E+00 (FGTVLTEHVAAAELGAR;GEPGRPALYFCGSIR;ILCLFRPQSGR;LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGR;RFGTVLTEHVAAAELGAR;ILCLFR;FQVWDYEEGEVEALLDR;YFEADPPGQVAASPDPTT) - - - - 1 IPI00007926.1
393 IPI00007927.3 Isoform 1 of Structural maintenance of chromosome 2-like 1 protein Cyto(SP,GO); Nucl(SP,GO) - - - - - 1.08E-02 (FPNLRFAYKDPEK;KTIEESEETLK) 3 IPI00007927.3, IPI00232806.1, IPI00472279.2
394 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 Nucl(G1,GO) - 1.80E-02 (NNVNVASLTQSEIR;TEDPDLPAFYFDPLINPISHR;EAVVNTQELLDLLVK;YLTEHPDPNNENIVGYNNK;NLNYLHLDYNFNLKPVK;DNPNLLFNMCGFECR;FTLWWSPTINR;QYQVLKQNPFWWTHQR) - - - 8.40E-02 (DGPYITAEEAVAVYTTTVHWLESR;NLNYLHLDYNFNLKPVK;DINLQDEDWNEFNDINK;EAVVNTQELLDLLVK;EELGLIEQAYDNPHEALSR;LANQLLTDLVDDNYFYLFDLK;TDMIQALGGVEGILEHTLFK;YIQPWESEFIDSQR;YLTEHPDPNNENIVGYNNK;DGVWNLQNEVTK;SQ 1 IPI00007928.4
395 IPI00007940.5 SPFH domain-containing protein 1 precursor ER(G1) 4.41E-01 (EALEPSGENVIQNK;ISEIEDAAFLAR;SVQTTLQTDEVK;IEVVNMLAPYAVFDIVR;IEEGHLAVYYR) - - 1.44E+00 (ISEIEDAAFLAR;SVQTTLQTDEVK;DLNLMAPGLTIQAVR;EALEPSGENVIQNK;GGALLTSPSGPGYHIMLPFITTFR;IEEGHLAVYYR;IEVVNMLAPYAVFDIVR;NFELMEAEK;LTPEYLELKK) 2.46E+00 (ISEIEDAAFLAR;SVQTTLQTDEVK;DLNLMAPGLTIQAVR;EALEPSGENVIQNK;IEEGHLAVYYR;IEVVNMLAPYAVFDIVR;LTPEYLELK;NFELMEAEK;VLVAAVVGLVAVLLYASIHK;GGALLTSPSGPGYHIMLPFITTFR;LTPEYLELKK) 6.10E-01 (EALEPSGENVIQNK;IEEGHLAVYYR;IHHELNQFCSAHTLQEVYIELFDQIDENLK;ISEIEDAAFLAR;SVQTTLQTDEVK) 2 IPI00795223.1, IPI00007940.5
396 IPI00007961.4 NADH-ubiquinone oxidoreductase chain 1 Mito(G1,GO,MitoP2) - - 5.46E-01 (GPNVVGPYGLLQPFADAMK;KGPNVVGPYGLLQPFADAMK) - - - 2 IPI00007961.4, IPI00760872.1
397 IPI00008040.4 Protein-arginine deiminase type-1 Cyto(SP) - - - - - 2.61E-02 (QVLGPQCLSYEVER;GGNSLSDYK) 1 IPI00008040.4
398 IPI00008135.4 Novel protein Cyto(G2) - - - 1.32E-02 (LSETISASNAWKSHYEKIVIEK;CTSESHLSCLK) - - 3 IPI00008135.4, IPI00556188.1, IPI00737794.1
399 IPI00008144.2 Isoform 1 of Neurabin-1 Nucl(G2) - - - 1.23E-02 (RNDEVDPVAASAEYELEK;LYDSVSSTDGEDSLERK) - - 1 IPI00008144.2
400 IPI00008157.2 CDNA FLJ44026 fis, clone TESTI4026762 Cyto(G2) - 6.52E-03 (FSTPDAAPVSTEPAWLALAK;QELLEEEGEGQEPPLEAER) - - - - 1 IPI00008157.2
401 IPI00008161.8 ATP12A protein PM(G2,GO) - - - 1.45E-02 (LFIRLYPGSWWDKNMYY;AVIGDASETALLKFSEVILGDVMEIR) 1.56E-02 (LFIRLYPGSWWDKNMYY;NHKEEFQKELHLDDHK) - 1 IPI00008161.8
402 IPI00008164.1 Prolyl endopeptidase Cyto(SP) - 2.80E-01 (FIATLQYIVGR;GIDASDYQTVQIFYPSK;KDTEIFYQFTSFLSPGIIYHCDLTK;LIDNFEGEYDYVTNEGTVFTFK;LPEADDIQYPSMLLLTADHDDR;LYYHVLGTDQSEDILCAEFPDEPK;NILQLHDLTTGALLK;QNCFDDFQCAAEYLIK;TFPLDVGSIVGYSGQK;YTIGHAWTTDYGC - - - - 2 IPI00008164.1, IPI00747355.1
403 IPI00008167.1 Sodium/potassium-transporting ATPase subunit beta-3 ER(G2); PM(GO) - - - - 1.30E-01 (KLHVGYLQPLVAVQVSFAPNNTGK;LFIYNPTTGEFLGR) - 1 IPI00008167.1
404 IPI00008215.1 NADP-dependent malic enzyme Cyto(SP) - 8.60E-02 (NFEHLNSDFDR;YGMNCLIQFEDFANVNAFR;GSEYDDFLDEFMEAVSSK;NQYCTFNDDIQGTASVAVAGLLAALR;QITDNIFLTTAEVIAQQVSDK;QQLNIHGLLPPSFNSQEIQVLR;GHIASVLNAWPEDVIK;LSDQTILFQGAGEAALGIAHLIVMALEK) - - - - 1 IPI00008215.1
405 IPI00008219.1 UV excision repair protein RAD23 homolog A Cyto(G2); Nucl(SP) - 7.44E-02 (EDKSPSEESAPTTSPESVSGSVPSSGSSGR;ILSDDVPIR;ALGFPESLVIQAYFACEK) - - - - 1 IPI00008219.1
406 IPI00008223.3 UV excision repair protein RAD23 homolog B Nucl(SP,GO,HPA); Cyto(SP,GO,HPA) - 8.09E-01 (ALGFPEGLVIQAYFACEK;NFVVVMVTKPK;QEKPAEKPAETPVATSPTATDSTSGDSSR;ESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLR;QIIQQNPSLLPALLQQIGR) - - - 1.06E+00 (ALGFPEGLVIQAYFACEK;NFVVVMVTKPK;QEKPAEKPAETPVATSPTATDSTSGDSSR;ESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLR;QIIQQNPSLLPALLQQIGR;IDIDPEETVK) 1 IPI00008223.3
407 IPI00008234.2 cytochrome b5 reductase b5R.2 ER(G2) - 2.93E-02 (LFYHGPGNLGIRPDQTSEPK;FGLPSPDHVLGLPVGNYVQLLAK) - - - - 2 IPI00008234.2, IPI00332396.5
408 IPI00008236.6 cytochrome b5 reductase 4 ER(SP,GO) - - - 2.00E-02 (LIEVTEEELKK;ILNYALTDIPSLR) - - 2 IPI00008236.6, IPI00793529.1
409 IPI00008240.2 Methionyl-tRNA synthetase, cytoplasmic Cyto(G1,GO,HPA) - 2.06E-01 (ALEEGLTPQEICDK;NVLITSALPYVNNVPHLGNIIGCVLSADVFAR;GLESLPPLRPQQNPVLPVAGER;ALEEGLTPQEICDKYHIIHADIYR;ITQDIFQQLLK;NNSELLNNLGNFINR;PAVVETVTTAKPQQIQALMDEVTK;QLAVAEGKPPEAPK;VPVLQLDSGNYLFSTSAICR;GFVLQ - 1.82E-02 (NEVAAEVAKLLDLKK;NNSELLNNLGNFINR) - - 1 IPI00008240.2
410 IPI00008274.6 Adenylyl cyclase-associated protein 1 Cyto(G1) - 1.79E+00 (AGAAPYVQAFDSLLAGPVAEYLK;AYLSIWTELQAYIK;LSDLLAPISEQIK;ALLVTASQCQQPAENK;EFHTTGLAWSK;KEPAVLELEGK;KLGLVFDDVVGIVEIINSK;LGLVFDDVVGIVEIINSK;NSLDCEIVSAK;VPTISINK;SGPKPFSAPKPQTSPSPK;VENQENVSNLVIEDTEL - - 4.07E-02 (AGAAPYVQAFDSLLAGPVAEYLK;PGPYVKEMNDAAMFYTNRVLK;LGLVFDDVVGIVEIINSK) 1.45E-01 (AGAAPYVQAFDSLLAGPVAEYLK;LGLVFDDVVGIVEIINSK) 1 IPI00008274.6
411 IPI00008289.4 Isoform 2 of BRCA1/BRCA2-containing complex subunit 3 Cyto(G2); Nucl(SP,GO) - 6.25E-02 (ILCQEEQDAYR;IHSLTHLDSVTK;VLYTCFQSIQAQK;IEIPIHIVPHVTIGK) - - - - 3 IPI00008289.4, IPI00218992.3, IPI00788931.1
412 IPI00008293.4 similar to 40S ribosomal protein S7 Cyto(G2) - 2.05E-02 (VETFSGVYK;KAIIILVPVTQLKSFQK) - - - - 1 IPI00008293.4
413 IPI00008307.1 Protein-arginine deiminase type-4 Cyto(SP,GO,HPA); Nucl(SP) - - - - - 5.69E-02 (ELGLAESDIIDIPQLFK;VQISYYGPKTPPVK) 1 IPI00008307.1
414 IPI00008315.4 Isoform 1 of Ephrin type-B receptor 1 precursor PM(G2,GO) - 1.00E-02 (GTCIPNAEEVDVPIK;VQISQSPTAMA) - - - - 3 IPI00008315.4, IPI00219244.1, IPI00334334.1
415 IPI00008351.2 Selenoprotein T precursor ER(G1) 1.19E-01 (IEGENYLPQPIYR;LKMQYATGPLLK) - - 4.32E-01 (IEGENYLPQPIYR;LESGHLPSMQQLVQILDNEMK;LNVHMDSIPHHR) 1.16E-01 (IEGENYLPQPIYR;LESGHLPSMQQLVQILDNEMK) - 1 IPI00008351.2
416 IPI00008359.1 Keratin, type II cytoskeletal 2 oral Nucl(G2); Cyto(HPA) 2.92E-02 (FASFIDK;FLEQQNKVLETK;SQGFSGRSAVVSGSSRMSCVAR) - - - - - 1 IPI00008359.1
417 IPI00008367.1 Carboxylesterase-related protein ER(G1,GO) - - - 2.78E-01 (FTPPQPAEPWSFVK;LSEDCLYLNIYTPADLTK;AISESGVALTSVLVK;AISESGVALTSVLVKK;KGDVKPLAEVGLR;GGQLISELFTNR) - - 1 IPI00008367.1
418 IPI00008380.1 Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform Cyto(G1,SP,GO); Nucl(SP) - 1.61E-01 (ELDQWIEQLNECK;YFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIR;YSFLQFDPAPR;GAGYTFGQDISETFNHANGLTLVSR;GYYSVETVTLLVALK;NVVTIFSAPNYCYR) - - - - 1 IPI00008380.1
419 IPI00008403.2 Carbohydrate sulfotransferase 7 Cyto(G2) - - - 1.26E-01 (SLGVWSLEAAAAGER;FHRVLLAHGVGARPGGQSR;DVRLLDLGVLVPLLR) - - 1 IPI00008403.2
420 IPI00008405.3 Arylsulfatase F precursor Cyto(G2) - - - 1.39E-02 (GMGGWEGGIR;DPSESTPLTPATEPLYDFVIKK) - - 1 IPI00008405.3
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home