Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
421 IPI00008418.5 Isoform 1 of Diablo homolog, mitochondrial precursor Mito(SP,GO,MitoP2,HPA); Cyto(GO) 9.04E-01 (AESEQEAYLRED;AVYTLTSLYR;LQVEEVHQLSR;LAEAQIEELR) 3.36E-01 (AVYTLTSLYR;LQVEEVHQLSR;LAEAQIEELR;TQEEGEERAESEQEAYLRED;AESEQEAYLRED) 5.55E-01 (LAEAQIEELR;LQVEEVHQLSR;AESEQEAYLRED) 1.19E-01 (LQVEEVHQLSR;LAEAQIEELR) 3.05E-01 (AESEQEAYLRED;LQVEEVHQLSR;LAEAQIEELR) 2.41E-01 (LQVEEVHQLSR;AESEQEAYLRED) 3 IPI00008418.5, IPI00219865.1, IPI00789460.1
422 IPI00008433.3 40S ribosomal protein S5 Cyto(G1,GO) - 1.05E+00 (TIAECLADELINAAK;WSTDDVQINDISLQDYIAVK;RVNQAIWLLCTGAR;VNQAIWLLCTGAR;QAVDVSPLR) - - - 1.37E-01 (HAFEIIHLLTGENPLQVLVNAIINSGPR;TIAECLADELINAAK) 1 IPI00008433.3
423 IPI00008438.1 40S ribosomal protein S10 Cyto(SP,GO); Nucl(SP,GO) - 1.25E+00 (AEAGAGSATEFQFR;KAEAGAGSATEFQFR;HFYWYLTNEGIQYLR;IAIYELLFK;DYLHLPPEIVPATLR) - 5.63E-01 (AEAGAGSATEFQFR;HFYWYLTNEGIQYLR;IAIYELLFK;KAEAGAGSATEFQFR;DYLHLPPEIVPATLR) 2.20E-01 (AEAGAGSATEFQFR;HFYWYLTNEGIQYLR;IAIYELLFK;KAEAGAGSATEFQFR;DYLHLPPEIVPATLR) - 1 IPI00008438.1
424 IPI00008453.3 Coronin-1C Cyto(G2) - 7.75E-02 (AIFLADGNVFTTGFSR;KSDLFQDDLYPDTAGPEAALEAEEWFEGK;YFEITDESPYVHYLNTFSSK;SIKDTICNQDER) - - - - 1 IPI00008453.3
425 IPI00008454.1 DnaJ homolog subfamily B member 11 precursor ER(SP,GO,HPA) - - - 6.75E-01 (DGMEYPFIGEGEPHVDGEPGDLR;FQDLGAAYEVLSDSEK;FQDLGAAYEVLSDSEKR;GSLIITFDVDFPK;KGEGLPNFDNNNIK;KLALQLHPDRNPDDPQAQEK;LALQLHPDRNPDDPQAQEK;TLEVEIEPGVR) 6.37E-01 (DGHQSSHGDIFSHFFGDFGFMFGGTPR;FQDLGAAYEVLSDSEK;FQDLGAAYEVLSDSEKR;GSLIITFDVDFPK;KGEGLPNFDNNNIK;LALQLHPDRNPDDPQAQEK;TLEVEIEPGVR;DGMEYPFIGEGEPHVDGEPGDLR;KLALQLHPDRNPDDPQAQEK) 6.29E-02 (FQDLGAAYEVLSDSEK;FQDLGAAYEVLSDSEKR) 1 IPI00008454.1
426 IPI00008475.1 Hydroxymethylglutaryl-CoA synthase, cytoplasmic Cyto(SP,GO) - 4.78E-01 (LEVGTETIIDK;DVGIVALEIYFPSQYVDQAELEKYDGVDAGK;LREDTHHLVNYIPQGSIDSLFEGTWYLVR;LSIQCYLSALDR;DKNSIYSGLEAFGDVK;EDTHHLVNYIPQGSIDSLFEGTWYLVR;IGVFSYGSGLAATLYSLK;LPATAAEPEAAVISNGEH;NNLSYDCIGR;PTGGVGAVA - - - - 1 IPI00008475.1
427 IPI00008483.1 Amine oxidase [flavin-containing] A Mito(G1,SP,GO,MitoP2) 3.96E+00 (NEHVDYVDVGGAYVGPTQNR;DIWVQEPESK;DVPAVEITHTFWER;EIPTDAPWEAQHADK;ELGIETYK;GAFPPVWNPIAYLDYNNLWR;IFFAGTETATK;IFSVTNGGQER;IHFRPELPAER;IIGFSTSVTALGFVLYK;LLTEYGVSVLVLEAR;LNHPVTHVDQSSDNIIIETLNHEHYEC 6.40E-02 (IIGFSTSVTALGFVLYK;LNHPVTHVDQSSDNIIIETLNHEHYECK;VLGSQEALHPVHYEEK;IFSVTNGGQER;NEHVDYVDVGGAYVGPTQNR;YVINAIPPTLTAK) 3.04E+00 (DVPAVEITHTFWER;EIPTDAPWEAQHADK;ELGIETYK;IHFRPELPAER;IIGFSTSVTALGFVLYK;LLTEYGVSVLVLEAR;LNHPVTHVDQSSDNIIIETLNHEHYECK;GAFPPVWNPIAYLDYNNLWR;VLGSQEALHPVHYEEK;VTEKDIWVQEPESK;IFFAGTETATK;IFSVTNGGQE 3.34E-01 (DVPAVEITHTFWER;ELGIETYK;GAFPPVWNPIAYLDYNNLWR;IFFAGTETATK;LLTEYGVSVLVLEAR;NEHVDYVDVGGAYVGPTQNR;VLGSQEALHPVHYEEK;YVINAIPPTLTAK;WSGYMEGAVEAGER;IFSVTNGGQER;LPMGAVIK;DIWVQEPESK;IHFRPELPAER) 1.18E+00 (ASIAGHMFDVVVIGGGISGLSAAK;DVPAVEITHTFWER;ELGIETYK;GAFPPVWNPIAYLDYNNLWR;IFFAGTETATK;IHFRPELPAER;IIGFSTSVTALGFVLYK;LLTEYGVSVLVLEAR;NEHVDYVDVGGAYVGPTQNR;NLPSVSGLLK;VLGSQEALHPVHYEEK;YVINAIPPTLTAK 1.29E-01 (IHFRPELPAER;LLTEYGVSVLVLEAR;LNHPVTHVDQSSDNIIIETLNHEHYECK;VLGSQEALHPVHYEEK;NEHVDYVDVGGAYVGPTQNR;IFFAGTETATK) 1 IPI00008483.1
428 IPI00008485.1 Iron-responsive element-binding protein 1 Cyto(SP,GO); ER(GO) - 3.42E+00 (FVEFFGPGVAQLSIADR;INPVCPADLVIDHSIQVDFNR;KQDIENILHWNVTQHK;NIEVPFKPAR;PHPLVTSTDIVLTITK;WGSQAFHNMR;YLQAVGMFR;ATIANMCPEYGATAAFFPVDEVSITYLVQTGR;ATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEK;DFNDPSQDPDFTQV - - 3.48E-02 (FVEFFGPGVAQLSIADR;YQQAGLPLIVLAGK) - 1 IPI00008485.1
429 IPI00008494.4 Intercellular adhesion molecule 1 precursor ER(G1); PM(G1,GO,HPA); Cyto(HPA) 4.74E-01 (ASVSVTAEDEGTQR;DGTFPLPIGESVTVTR;EPAVGEPAEVTTTVLVR;LLGIETPLPK;REPAVGEPAEVTTTVLVR;VTLNGVPAQPLGPR;VELAPLPSWQPVGK) - - - 4.14E-01 (ASVSVTAEDEGTQR;DGTFPLPIGESVTVTR;EPAVGEPAEVTTTVLVR;LLGIETPLPK;VTLNGVPAQPLGPR) - 2 IPI00008494.4, IPI00642425.1
430 IPI00008495.4 NADH-ubiquinone oxidoreductase chain 4 Mito(G1,GO,MitoP2) - - 6.43E-01 (AHVEAPIAGSMVLAAVLLK;LIVPTIMLLPLTWLSK;LTLILNPLTK) - - - 1 IPI00008495.4
431 IPI00008511.1 NADH-ubiquinone oxidoreductase chain 5 Mito(G1,GO,MitoP2) - - 6.24E-01 (SPLCTFYFSNMLGFYPSITHR;TISQHQISTSIITSTQK;FPTLTNINENNPTLLNPIK;FPTLTNINENNPTLLNPIKR;ADANTAAIQAILYNR) - - 1.06E-01 (TISQHQISTSIITSTQK;FPTLTNINENNPTLLNPIK) 1 IPI00008511.1
432 IPI00008522.3 Sodium channel protein type 10 subunit alpha PM(G2) - - - - 1.30E-02 (KGSLSVLR;WNIFDCIIVTVSLLELGVAK) - 2 IPI00008522.3, IPI00783779.1
433 IPI00008524.1 Isoform 1 of Polyadenylate-binding protein 1 Cyto(G1,SP,GO); Nucl(SP) - 5.20E-01 (ALYDTFSAFGNILSCK;EFSPFGTITSAK;FSPAGPILSIR;GFGFVCFSSPEEATK;GYGFVHFETQEAAER;ITGMLLEIDNSELLHMLESPESLR;NLDDGIDDER;PLYVALAQR;IVATKPLYVALAQR;KEFSPFGTITSAK;LFPLIQAMHPTLAGK;SKVDEAVAVLQAHQAK;SLGYAYVN - - - - 4 IPI00796945.1, IPI00478522.1, IPI00410017.1, IPI00008524.1
434 IPI00008527.3 60S acidic ribosomal protein P1 ER(G1); Cyto(GO,HPA) - 2.95E-01 (AAGVNVEPFWPGLFAK;ALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEK) - 4.55E+00 (AAGVNVEPFWPGLFAK;KEESEESDDDMGFGLFD) - - 1 IPI00008527.3
435 IPI00008529.1 60S acidic ribosomal protein P2 ER(G1); Cyto(GO) - 2.95E-01 (ILDSVGIEADDDRLNK;LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK) - 8.14E+00 (KEESEESDDDMGFGLFD;ILDSVGIEADDDR;ILDSVGIEADDDRLNK;ILDSVGIEADDDRLNKVISELNGK;KILDSVGIEADDDRLNK;LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK;LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKK;LASVPAGGAVAVSAAPGSAAPAAGSAPAA 6.41E+00 (ILDSVGIEADDDR;ILDSVGIEADDDRLNK;KILDSVGIEADDDRLNK;LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK;NIEDVIAQGIGK;YVASYLLAALGGNSSPSAK) 4.42E-01 (ILDSVGIEADDDRLNK;NIEDVIAQGIGK;YVASYLLAALGGNSSPSAK) 1 IPI00008529.1
436 IPI00008530.1 60S acidic ribosomal protein P0 Cyto(SP,GO,HPA); Nucl(SP,GO) 1.01E-01 (GNVGFVFTK;TSFFQALGITTK) 6.59E-01 (AFLADPSAFVAAAPVAAATTAAPAAAAAPAK;TSFFQALGITTK;AGAIAPCEVTVPAQNTGLGPEK;GNVGFVFTK;GTIEILSDVQLIK;NVASVCLQIGYPTVASVPHSIINGYK;VLALSVETDYTFPLAEK;CFIVGADNVGSK) - 3.40E+00 (AFLADPSAFVAAAPVAAATTAAPAAAAAPAK;GNVGFVFTK;GTIEILSDVQLIK;TSFFQALGITTK;VEAKEESEESDEDMGFGLFD;VLALSVETDYTFPLAEK;EDLTEIRDMLLANK;IIQLLDDYPK) 2.33E+00 (AFLADPSAFVAAAPVAAATTAAPAAAAAPAK;GNVGFVFTK;GTIEILSDVQLIK;TSFFQALGITTK;VLALSVETDYTFPLAEK;IIQLLDDYPK) 3.35E-01 (AFLADPSAFVAAAPVAAATTAAPAAAAAPAK;TSFFQALGITTK;GNVGFVFTK;GTIEILSDVQLIK;NVASVCLQIGYPTVASVPHSIINGYK;VLALSVETDYTFPLAEK) 1 IPI00008530.1
437 IPI00008531.1 REST corepressor 1 Cyto(G1); Nucl(G1,SP,GO) - 1.91E-02 (KEVPPTETVPQVK;WTTEEQLLAVQAIR) - - - 5.16E-02 (SLADLPNFTPFPDEWTVEDK;WTTEEQLLAVQAIR) 1 IPI00008531.1
438 IPI00008552.6 Thioredoxin-like protein 2 Cyto(G2,SP) - 6.37E-02 (IDRLDGAHAPELTK;LEAEGVPEVSEK;YEISSVPTFLFFK;HASSGSFLPSANEHLK) - - 3.87E-02 (YEISSVPTFLFFK;ELPQVSFVK) - 1 IPI00008552.6
439 IPI00008569.1 YKT6 v-SNARE protein Cyto(SP,GO); ER(GO); Mito(GO); PM(GO) - 3.62E-02 (AAYDVSSFSFFQR;NDSLAGVVIADNEYPSR) - - - - 1 IPI00008569.1
440 IPI00008575.3 Isoform 1 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 Nucl(SP,GO) 4.54E-02 (GDSKKDDEENYLDLFSHK;LKERVLIPVK) - 2.57E-02 (KDDEENYLDLFSHK;FNFVGKILGPQGNTIK) 2.74E-02 (LQEETGAKISVLGKGSMR;FNFVGKILGPQGNTIKR) 2.94E-02 (FNFVGKILGPQGNTIKR;LQEETGAKISVLGKGSMR) 3.83E-01 (GDSKKDDEENYLDLFSHK;KDDEENYLDLFSHK;SSGRSGSMDPSGAHPSVRQTPSR) 3 IPI00008575.3, IPI00385834.3, IPI00479209.1
441 IPI00008599.2 3-beta-hydroxysteroid-Delta ER(SP,GO,HPA); PM(GO) - - - - 1.39E-01 (LDNFVPNDR;AAVVPLGTWR) - 3 IPI00008599.2, IPI00642218.1, IPI00643669.1
442 IPI00008603.1 Actin, aortic smooth muscle Cyto(G1,SP,GO) - 8.09E-01 (EITALAPSTMK;IIAPPERKYSVWIGGSILASLSTFQQMWISK;AVFPSIVGR;AVFPSIVGRPR;SYELPDGQVITIGNER;DLTDYLMK;AGFAGDDAPR;IKIIAPPER;YPIEHGIITNWDDMEK;VAPEEHPTLLTEAPLNPK;IWHHSFYNELR;LCYVALDFENEMATAASSSSLEK;QEYDE 1.80E-02 (AVFPSIVGR;SYELPDGQVITIGNER;GYSFVTTAER) - - - 1 IPI00008603.1
443 IPI00008669.2 38 kDa protein Cyto(G2) - - 5.20E-02 (SDLEANVEALTQEIDFLR;KSDLEANVEALTQEIDFLR) - - - 1 IPI00008669.2
444 IPI00008692.1 Keratin, type I cuticular Ha6 Cyto(G2) 2.15E-02 (LAADDFR;ARLEGEIATYR) - 1.46E-02 (ILDELTLCK;QNQEYQVLLDVK) - - - 2 IPI00795958.1, IPI00008692.1
445 IPI00008726.3 Iron-responsive element-binding protein 2 Cyto(SP) - 1.03E-02 (QGDLVTCGILSGNK;HLEHTGFSK) - - - 1.85E-02 (EGIPLIILAGK;STYIRCPSFFDK) 1 IPI00008726.3
446 IPI00008728.1 ATP-dependent Clp protease ATP-binding subunit ClpX-like, mitochondrial precursor Mito(SP,GO,MitoP2,HPA); Nucl(HPA) - - - - 1.81E-02 (YVVGQSFAKK;KVLSVAVYNHYK) - 1 IPI00008728.1
447 IPI00008787.3 Alpha-N-acetylglucosaminidase precursor ER(G2) 5.49E-02 (AGGVLAYELLPALDEVLASDSR;LLLTSAPSLATSPAFR;EAAAVRALVAR) 3.13E-02 (AGGVLAYELLPALDEVLASDSR;DPVPDLAAWVTSFAARR) 6.21E-02 (AAAVSEAEADFYEQNSR;AGGVLAYELLPALDEVLASDSR;LLLTSAPSLATSPAFR) - - - 1 IPI00008787.3
448 IPI00008791.1 WD repeat protein 39 Cyto(G2) - 3.44E-02 (EPGLLASCSDDGEVAFWK;CICTLSGFHSR) - - - - 1 IPI00008791.1
449 IPI00008816.1 Isoform 1 of DNA repair protein REV1 Nucl(G2,GO) - 7.64E-03 (TIGSPKRIQSPLNNK;PGAPVETAK) - - - - 2 IPI00008816.1, IPI00552928.1
450 IPI00008842.1 Beta-ureidopropionase Cyto(SP,GO) - 2.94E+00 (AHQDFGYFYGSSYVAAPDSSR;HLPLPDLQEVK;KAHQDFGYFYGSSYVAAPDSSR;LDLNLCQQVNDVWNFK;LPWTEFAESAEDGPTTR;NHDMVVVSPILER;SNYSPTIVKE;DSEHGDVLWNTAVVISNSGAVLGK;EAFEAASREDFELQGYAFEAAEEQLR;EDFELQGYAFEAAEEQLR;EK - - 1.26E-01 (AHQDFGYFYGSSYVAAPDSSR;EDFELQGYAFEAAEEQLR;EKLPWTEFAESAEDGPTTR;IPLPANAPVAEQVSALHR;VGDFNESTYYMEGNLGHPVFQTQFGR;LPWTEFAESAEDGPTTR) - 1 IPI00008842.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home