Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
451 IPI00008867.1 Glycogen [starch] synthase, liver Cyto(G1,GO) 2.98E-02 (TNNFNVETLKGQAVR;TQVEQCEPVNDAVR) 1.18E+00 (FHVELTSPPTTEGFK;FSAVHEFQNLHAMYK;GADIFLESLSR;GDLWEACSVGIPYHDR;LPIATIFTTHATLLGR;YLCAANIDFYNHLDKFNIDK;RKPDVVTPNGLNVK;SPFSLSHVPHGK;TLFLFIAGR;TNNFNVETLK;TQVEQCEPVNDAVR;VGGIYTVIQTK;VILHPEFLSSTSPLL - 1.72E+00 (AFPDKFHVELTSPPTTEGFK;EANDMLIFGSLTAWFLK;FHVELTSPPTTEGFK;FSAVHEFQNLHAMYK;GADIFLESLSR;GEIPDLNDILDRDDLTIMK;GHFYGHLDFDLEK;KFSAVHEFQNLHAMYK;KLPIATIFTTHATLLGR;KQLWDVAHSVK;LPIATIFTTHATLLGR;QSLPPVTTH 1.04E-01 (FHVELTSPPTTEGFK;FSAVHEFQNLHAMYK;GEIPDLNDILDRDDLTIMK;LPIATIFTTHATLLGR;VGGIYTVIQTK;KLPIATIFTTHATLLGR;VILHPEFLSSTSPLLPMDYEEFVR;SPFSLSHVPHGK) - 1 IPI00008867.1
452 IPI00008905.1 UDP-glucuronosyltransferase 2B15 precursor ER(G1) 2.74E+00 (KWDQFYSEVLGR;WDQFYSEVLGR;WIPQNDLLGHPK;DLLNALK;GAALSVDIR;LEVYPTSLTK;TILEELVQR;FCLFCFR;PFLPNVDFVGGLHCK;SVINDPVYK;TYWDFEFPR;TYWDFEFPRPFLPNVDFVGGLHCK;AEMWLIR;FSVGYTFEK;WIYGVSK;NDLEDSLLK) - 2.89E-02 (WDQFYSEVLGR;TYWDFEFPRPFLPNVDFVGGLHCK;TILEELVQR) 4.71E+00 (AVFWIEFVMR;KWDQFYSEVLGR;WDQFYSEVLGR;WIPQNDLLGHPK;KWDQFYSEVLGRPTTLFETMGK;PTTLFETMGK;WDQFYSEVLGRPTTLFETMGK;LEVYPTSLTK;AFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMK;DLLNALK;GAALSVDIR;NGGGFLFPPSYVPVVMS 1.98E+00 (AVFWIEFVMR;KWDQFYSEVLGR;WDQFYSEVLGR;WIPQNDLLGHPK;KWDQFYSEVLGRPTTLFETMGK;WDQFYSEVLGRPTTLFETMGK;PTTLFETMGK;LEVYPTSLTK;AFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMK;GAALSVDIR;TILEELVQR;DLLNALK;NGGGFLF 2.35E-01 (GAALSVDIR;LEVYPTSLTK;WIPQNDLLGHPK;DLLNALK;KWDQFYSEVLGR;WDQFYSEVLGR;SVINDPVYK;TYWDFEFPRPFLPNVDFVGGLHCK;TMSSRDLLNALKSVINDPVYK;FSVGYTFEK;NDLEDSLLK) 1 IPI00008905.1
453 IPI00008918.1 Isoform Beta of LIM domain and actin-binding protein 1 Nucl(G2); PM(GO,HPA); Cyto(SP,GO,HPA) 4.24E-02 (ISANENSLAVR;STPAEDDSRDSQVK) - - - - - 4 IPI00008918.1, IPI00220465.1, IPI00220466.1, IPI00796222.1
454 IPI00008934.1 Hydroxymethylglutaryl-CoA synthase, mitochondrial precursor Mito(SP,GO,MitoP2) 6.97E+00 (DVGILALEVYFPAQYVDQTDLEK;GLEAFGGLK;IGAFSYGSGLAASFFSFR;LEVGTETIIDK;PTGGAGAVAMLIGPK;VNFSPPGDTNSLFPGTWYLER;VSQDAAPGSPLDK;YTVGLGQTR;IQLPWDSVGR;LSIQCYLR;LEDTYTNKDLDK) 6.53E+00 (ASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSR;CVSPEEFTEIMNQR;DVGILALEVYFPAQYVDQTDLEK;DVGILALEVYFPAQYVDQTDLEKYNNVEAGK;GLEAFGGLK;LEDTYTNKDLDK;LSIQCYLR;IGAFSYGSGLAASFFSFR;QAGSDRPFTLDDLQYMIFHTPFCK;VNFSP 6.42E+01 (ASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSR;CVSPEEFTEIMNQR;DVGILALEVYFPAQYVDQTDLEK;DVGILALEVYFPAQYVDQTDLEKYNNVEAGK;GLEAFGGLK;LEDTYTNKDLDK;LSIQCYLR;LVSSTSDLPK;PNLASEYPIVDGK;QAGSDRPFTLDDLQYMIFHTPFCK 4.20E-01 (DVGILALEVYFPAQYVDQTDLEK;GTHMENVYDFYKPNLASEYPIVDGK;IGAFSYGSGLAASFFSFR;LEVGTETIIDK;LMFNDFLSASSDTQTSLYK;PTGGAGAVAMLIGPK;VNFSPPGDTNSLFPGTWYLER;GLEAFGGLK) 2.96E-01 (DVGILALEVYFPAQYVDQTDLEK;GTHMENVYDFYKPNLASEYPIVDGK;IGAFSYGSGLAASFFSFR;LMFNDFLSASSDTQTSLYK;PTGGAGAVAMLIGPK;VNFSPPGDTNSLFPGTWYLER;VSQDAAPGSPLDK;YTVGLGQTR;PTGGAGAVAMLIGPKAPLALERGLR;LEVGTETIIDKSK 3.19E+00 (DVGILALEVYFPAQYVDQTDLEK;GLEAFGGLK;VNFSPPGDTNSLFPGTWYLER;GTHMENVYDFYKPNLASEYPIVDGK;IGAFSYGSGLAASFFSFR;IQLPWDSVGR;LSIQCYLR;VSQDAAPGSPLDK;YTVGLGQTR;LEVGTETIIDK) 1 IPI00008934.1
455 IPI00008943.3 Isoform 1 of ATP-dependent RNA helicase DDX19B Cyto(SP); Nucl(SP) - 4.20E-02 (SNLVDNTNQVEVLQR;FAQKVVPDPNVIK;VLVTTNVCAR;YPQCLCLSPTYELALQTGK) - - - - 4 IPI00008943.3, IPI00019918.5, IPI00027599.5, IPI00155054.1
456 IPI00008961.1 Telomeric repeat-binding factor 2-interacting protein 1 Nucl(SP,GO,HPA); Cyto(GO,HPA) - - - - - 2.17E-01 (FNLDLSTVTQAFLK;IAFTDADDVAILTYVK;LGPASAADTGSEAKPGALAEGAAEPEPQR;VQEPGAVLLAQPGEALAEASGDFISTQYILDCVER;NSGELEATSAFLASGQR;SSLTQHSWQSLK;YLLGDAPVSPSSQK;QDDIDLQKDDEDTR) 1 IPI00008961.1
457 IPI00008964.3 Ras-related protein Rab-1B Cyto(SP) 9.26E-01 (LLIIGDSGVGK;IQIWDTAGQER;FADDTYTESYISTIGVDFK;EFADSLGIPFLETSAK;MGPGAASGGERPNLK) 4.98E-01 (IQLWDTAGQER;FADDTYTESYISTIGVDFK;GAHGIIVVYDVTDQESYANVK;EFADSLGIPFLETSAK;MGPGAASGGERPNLK) - 1.71E+00 (IQIWDTAGQER;LLIIGDSGVGK;EFADSLGIPFLETSAK;FADDTYTESYISTIGVDFK;GAHGIIVVYDVTDQESYANVK;MGPGAASGGERPNLK;NATNVEQAFMTMAAEIK) 3.45E+00 (IQIWDTAGQER;LLIIGDSGVGK;EFADSLGIPFLETSAK;FADDTYTESYISTIGVDFK;GAHGIIVVYDVTDQESYANVK;MGPGAASGGERPNLK;NATNVEQAFMTMAAEIK) 2.66E-01 (IQLWDTAGQER;FADDTYTESYISTIGVDFK;GAHGIIVVYDVTDQESYANVK;EFADSLGIPFLETSAK) 1 IPI00008964.3
458 IPI00008982.1 Isoform Long of Delta 1-pyrroline-5-carboxylate synthetase Mito(SP,GO,MitoP2,HPA); Cyto(GO) - - 2.32E-02 (ILHLLTQEALSIHGVK;TDLLIVLSDVEGLFDSPPGSDDAK) - - - 2 IPI00008982.1, IPI00218547.1
459 IPI00008994.2 Isoform 1 of Protein NDRG2 Cyto(SP,GO,HPA); Nucl(GO,HPA) 2.74E+00 (MADSGGQPQLTQPGK;NIITHAPNLDNIELYWNSYNNR;TASLTSAASVDGNR) 1.64E+00 (LDPTQTSFLK;MADSGGQPQLTQPGK;RPAILTYHDVGLNYK;SCFQPLFQFEDMQEIIQNFVR;CPVMLVVGDQAPHEDAVVECNSK;NIITHAPNLDNIELYWNSYNNR;TASLTSAASVDGNR;LTGLTSSIPEMILGHLFSQEELSGNSELIQK;YALNHPDTVEGLVLINIDPNAK;ILLDQGQT - - 7.05E-01 (LTGLTSSIPEMILGHLFSQEELSGNSELIQK;RPAILTYHDVGLNYK;TASLTSAASVDGNR;YALNHPDTVEGLVLINIDPNAK;MADSGGQPQLTQPGK) - 1 IPI00008994.2
460 IPI00008998.1 HSPC121 ER(G1,SP) 1.68E-01 (LESEGSPETLTNLR;VELSDVQNPAISITENVLHFK;PLFLAPDFDR;RPLFLAPDFDR) - 2.28E-01 (GDNVYEFHLEFLDLVKPEPVYK;LESEGSPETLTNLR;VELSDVQNPAISITENVLHFK;RPLFLAPDFDR) 6.68E-01 (GDNVYEFHLEFLDLVKPEPVYK;LESEGSPETLTNLR;LRLESEGSPETLTNLR;VELSDVQNPAISITENVLHFK;RPLFLAPDFDR) 7.61E-01 (GDNVYEFHLEFLDLVKPEPVYK;LESEGSPETLTNLR;LRLESEGSPETLTNLR;VELSDVQNPAISITENVLHFK;WLDESDAEMELR;RPLFLAPDFDR) 3.35E-01 (GDNVYEFHLEFLDLVKPEPVYK;LRLESEGSPETLTNLR;RPLFLAPDFDR;LESEGSPETLTNLR;VELSDVQNPAISITENVLHFK) 1 IPI00008998.1
461 IPI00009028.1 Tetranectin precursor Nucl(G1) - - - - - 5.36E-01 (SRLDTLAQEVALLK;TENCAVLSGAANGKWFDK;LDTLAQEVALLK;GGTLSTPQTGSENDALYEYLR) 1 IPI00009028.1
462 IPI00009032.1 Lupus La protein Cyto(G1) - 4.82E-01 (ETDLLILFKDDYFAK;FASDDEHDEHDENGATGPVKR;FSGDLDDQTCR;GFPTDATLDDIKEWLEDK;GSIFVVFDSIESAK;GSIFVVFDSIESAKK;ICHQIEYYFGDFNLPR;YKETDLLILFK;YKETDLLILFKDDYFAK;EDLHILFSNHGEIK;LTTDFNVIVEALSK;SPSKPLPEVTDEY - - - - 1 IPI00009032.1
463 IPI00009044.1 Isoform 1 of Protocadherin alpha 4 precursor PM(G2,GO) - 9.56E-03 (DREDQLQTTEESFAK;AGMHSSVHLEEAGILR) - - - - 1 IPI00009044.1
464 IPI00009045.1 Isoform 1 of Protocadherin alpha 12 precursor PM(G2) - 1.13E-02 (AGMHSSVHLEEAGILR;KDKSILPELVLR) - - - - 1 IPI00009045.1
465 IPI00009057.2 Isoform A of Ras-GTPase-activating protein-binding protein 2 Cyto(SP,GO,HPA) - 3.77E-02 (NSSYVHGGVDASGKPQEAVYGQNDIHHK;FMQTFVLAPEGSVPNK) - - - - 2 IPI00009057.2, IPI00179890.2
466 IPI00009104.6 RuvB-like 2 Nucl(SP,GO); Cyto(SP) - 3.36E-02 (TQGFLALFSGDTGEIK;LLIVSTTPYSEK;AAGVVLEMIR) - - - 9.51E-01 (DKVQAGDVITIDK;EVVHTVSLHEIDVINSR;FVQCPDGELQK;GLGLDDALEPR;GTSYQSPHGIPIDLLDR;LLIVSTTPYSEK;TQGFLALFSGDTGEIK;VYSLFLDESR;KEVVHTVSLHEIDVINSR;EYQDAFLFNELK;TEALTQAFR) 1 IPI00009104.6
467 IPI00009123.1 Nucleobindin-2 precursor ER(G1); PM(GO); Cyto(SP,GO) - 1.72E-02 (LEYHQVIQQMEQK;EKLQKADIEEIK) - 1.21E-01 (LEYHQVIQQMEQK;LHDVNSDGFLDEQELEALFTK;LHDVNSDGFLDEQELEALFTKELEK;IEPPDTGLYYDEYLK;EYENIIALQENELK) 6.52E-02 (LEYHQVIQQMEQK;LHDVNSDGFLDEQELEALFTK;AKLDSLQDIGMDHQALLK;LVTLEEFLK) 3.09E-02 (LHDVNSDGFLDEQELEALFTK;LEYHQVIQQMEQK) 1 IPI00009123.1
468 IPI00009145.1 Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB ER(G2); Nucl(HPA) 3.32E-02 (FDLGLEDVLIPHVDAGK;WGQYHTSVGGLGDSFYEYLLK) - - - - - 2 IPI00009145.1, IPI00480193.1
469 IPI00009148.1 Diphosphoinositol polyphosphate phosphohydrolase 1 Cyto(G1) - 1.65E-01 (LVGIFENQER;SESEEEVLLVSSSR;VLQYHKPVQASYFETLR) - - - - 1 IPI00009148.1
470 IPI00009149.3 SGT1, suppressor of G2 allele of SKP1 Cyto(G2); Nucl(G2) - 9.02E-02 (ALEQKPDDAQYYCQR;AYCHILLGNYCVAVADAK;LFQQIYSDGSDEVKR;LPSGEDYNLK;LEGQGDVPTPK) - - - - 2 IPI00009149.3, IPI00791573.1
471 IPI00009225.1 Syntaxin-8 Cyto(G2); ER(GO); PM(GO) - - - - 4.97E-02 (AVSTHQITQLEGDR;IIQEQDAGLDALSSIISR) - 1 IPI00009225.1
472 IPI00009236.5 caveolin 1 PM(SP,GO); ER(GO) - - - - 5.02E-01 (IDFEDVIAEPEGTHSFDGIWK;YVDSEGHLYTVPIR) - 1 IPI00009236.5
473 IPI00009253.2 Alpha-soluble NSF attachment protein Cyto(G1,GO) 3.48E-01 (NSQSFFSGLFGGSSK;YEELFPAFSDSR) 4.72E-01 (AIAHYEQSADYYK;AIAHYEQSADYYKGEESNSSANK;HDAATCFVDAGNAFK;HHISIAEIYETELVDIEK;IEEACEIYAR;LLEAHEEQNVDSYTESVK;LLEAHEEQNVDSYTESVKEYDSISR;NSQSFFSGLFGGSSK;TIQGDEEDLR;VAGYAALLEQYQK;YEELFPAFSDSR;HDAATCF - 6.29E-01 (AIAHYEQSADYYK;AIAHYEQSADYYKGEESNSSANK;AIDIYEQVGTNAMDSPLLK;EAEAMALLAEAER;HHISIAEIYETELVDIEK;KLLEAHEEQNVDSYTESVK;LLEAHEEQNVDSYTESVK;NSQSFFSGLFGGSSK;VAGYAALLEQYQK;YEELFPAFSDSR) 1.78E+00 (AIAHYEQSADYYK;AIAHYEQSADYYKGEESNSSANK;AIDIYEQVGTNAMDSPLLK;EAEAMALLAEAER;HHISIAEIYETELVDIEK;KLLEAHEEQNVDSYTESVK;LLEAHEEQNVDSYTESVK;LLEAHEEQNVDSYTESVKEYDSISR;NSQSFFSGLFGGSSK;TIQGDEEDLR;VAGYAAL 1.94E-01 (AIAHYEQSADYYKGEESNSSANK;HHISIAEIYETELVDIEK;NSQSFFSGLFGGSSK;VAGYAALLEQYQK) 1 IPI00009253.2
474 IPI00009268.1 Aminoacylase-1 Cyto(G1,SP,GO) - 3.04E+00 (AFEEQLQSWCQAAGEGVTLEFAQK;CVSIQYLEAVR;EHWSHDPFEAFK;EHWSHDPFEAFKDSEGYIYAR;GPEEEHPSVTLFR;LEGGVAYNVIPATMSASFDFR;PDYGAAVAFFEETAR;VEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK;VVNSILAFR;WMHPQVTPTDDSNPWWAA - - 1.44E-01 (AGFALDEGIANPTDAFTVFYSER;LEGGVAYNVIPATMSASFDFR;VVNSILAFR;TVQPKPDYGAAVAFFEETAR;VEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK) 4.27E-02 (VEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK;GPEEEHPSVTLFR) 1 IPI00009268.1
475 IPI00009274.1 Coatomer subunit zeta-2 Cyto(G1) - 1.10E-01 (ADDGGLTEQSVAQVLQSAK;PHPGEGAAAAQAGGPAPPAR) - - - - 1 IPI00009274.1
476 IPI00009286.3 Isoform 1 of Zinc finger protein HRX Nucl(SP,GO) - - 8.72E-03 (TNLDLGPTAPSLEKEK;SPSVKTSPR;SSEGSAHNVAYPGIPK;CENLSDEMYEILSNLPESVAYTCVNCTER;ITHGKDISELPKGNK) - - 4.74E-03 (SLTDKVQEARSNAR;SPTVPSQNPSR) 3 IPI00009286.3, IPI00218500.5, IPI00783696.1
477 IPI00009302.1 Pleckstrin-2 Cyto(G2,SP) - - - - 3.42E-02 (ISPKEEISLSTVELSGTVVKQGYLAK;MEDGVLKEGFLVK) - 1 IPI00009302.1
478 IPI00009305.1 Glucosamine-6-phosphate isomerase Cyto(G1) - 3.29E-01 (AAGGIELFVGGIGPDGHIAFNEPGSSLVSR;HIDIHPENTHILDGNAVDLQAECDAFEEK;LIILEHYSQASEWAAK;YFTLGLPTGSTPLGCYK;IIQFNPGPEK;TVFVCDEDATLELK) - - - - 1 IPI00009305.1
479 IPI00009315.5 Golgi resident protein GCP60 Cyto(G2); Mito(MitoP2) - 6.25E-02 (THTDSSEKELEPEAAEEALENGPK;GPGASGEQPEPGEAAAGGAAEEAR;IQQDADSVITVGR;DCHEEVYAGSHQYPGR;QQEVVVAGSSLPTSSK) - - - - 1 IPI00009315.5
480 IPI00009322.2 E3 ubiquitin-protein ligase NEDD4 Nucl(G2,GO); Cyto(GO); PM(GO) - 6.79E-03 (DDFLGQVDVPLYPLPTENPR;LWIEFDGEKGLDYGGVAREWFFLISK) - - - - 1 IPI00009322.2
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home