Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
511 IPI00009802.1 Isoform V0 of Versican core protein precursor Cyto(G2) - 4.38E-03 (KPTENIIIDLDK;LHTTSAFKPSSAITK) 8.70E-03 (EETVMMEGSGDAAFR;SHFFLATALVTESIPAEHVVTDSPIKKEESTK;LPPALLTTVGMNGKDK) - - - 2 IPI00009802.1, IPI00215631.1
512 IPI00009803.1 Integrin alpha-4 precursor PM(G2,GO) - 1.00E-02 (ELNILHEMK;VFVYINSGSGAVMNAMETNLVGSDK) - - - - 1 IPI00009803.1
513 IPI00009822.1 Signal recognition particle 54 kDa protein Cyto(SP,GO); Nucl(SP,GO) - 1.43E-02 (SPIIFIGTGEHIDDFEPFK;GSGVSTRDVQELLTQYTKFAQMVK) - 2.02E-02 (SPIIFIGTGEHIDDFEPFK;SAIDLEEMASGLNK) - - 1 IPI00009822.1
514 IPI00009841.4 CDNA FLJ31747 fis, clone NT2RI2007377, highly similar to RNA-BINDING PROTEIN EWS Nucl(G1,SP); Cyto(SP); PM(SP) - - - - - 4.71E-01 (AAVEWFDGKDFQGSK;GDATVSYEDPPTAK) 3 IPI00009841.4, IPI00065554.3, IPI00293254.1
515 IPI00009851.4 PCDH12 protein PM(SP,GO) - - 1.99E-02 (DADSGANGEPLYSIR;RTNGNTYMLLTNATLDREQWPK) - - - 1 IPI00009851.4
516 IPI00009865.1 Keratin, type I cytoskeletal 10 ER(G1) 5.02E+00 (ADLEMQIESLTEELAYLK;ALEESNYELEGK;ELTTEIDNNIEQISSYK;GSLGGGFSSGGFSGGSFSR;NQILNLTTDNANILLQIDNAR;IRLENEIQTYR;LKYENEVALR;NVQALEIELQSQLALK;QSVEADINGLR;SQYEQLAEQNR;SQYEQLAEQNRK;TIDDLKNQILNLTTDNANILL 3.67E+00 (DAEAWFNEK;ELTTEIDNNIEQISSYK;GSLGGGFSSGGFSGGSFSR;IRLENEIQTYR;AETECQNTEYQQLLDIK;NQILNLTTDNANILLQIDNAR;QSLEASLAETEGR;SKELTTEIDNNIEQISSYK;TIDDLKNQILNLTTDNANILLQIDNAR;ALEESNYELEGK;LENEIQTYR;LKYEN - 1.76E+01 (LASYLDKVR;QSVEADINGLR;ADLEMQIESLTEELAYLK;ADLEMQIESLTEELAYLKK;SKELTTEIDNNIEQISSYK;ALEESNYELEGK;DAEAWFNEK;ELTTEIDNNIEQISSYK;GSLGGGFSSGGFSGGSFSR;IRLENEIQTYR;LKYENEVALR;TIDDLKNQILNLTTDNANILLQIDN 1.49E+01 (LASYLDKVR;QSVEADINGLR;ADLEMQIESLTEELAYLK;ALEESNYELEGK;DAEAWFNEK;ELTTEIDNNIEQISSYK;TIDDLKNQILNLTTDNANILLQIDNAR;GSLGGGFSSGGFSGGSFSR;IRLENEIQTYR;LKYENEVALR;NQILNLTTDNANILLQIDNAR;NVQALEIELQSQLAL - 1 IPI00009865.1
517 IPI00009866.6 Isoform 1 of Keratin, type I cytoskeletal 13 Nucl(G1) - 4.57E-02 (QSVEADINGLR;LEQEIATYR;TRLEQEIATYR;ALEEANADLEVK;VILEIDNAR;TDLEMQIESLNEELAYMK) - - 3.65E-02 (LEQEIATYR;TRLEQEIATYR;ALEEANADLEVK;QSVEADINGLR;TLQGLEIELQSQLSMK) 2.98E-01 (QSVEADINGLR;LEQEIATYR;ALEEANADLEVK;VILEIDNAR) 2 IPI00171196.2, IPI00009866.6
518 IPI00009867.2 Keratin, type II cytoskeletal 5 ER(G1); Cyto(GO) - 1.95E-02 (LALDVEIATYR;NLDLDSIIAEVK;QNLEPLFEQYINNLR;FASFIDK;LAELEEALQK;VSLAGACGVGGYGSR) - 1.43E-01 (NLDLDSIIAEVK;LAELEEALQK;LALDVEIATYR;QNLEPLFEQYINNLR;WTLLQEQGTK;YEELQQTAGR;FASFIDK;SFSTASAITPSVSR;NMQDLVEDFK) 3.01E-01 (NLDLDSIIAEVK;LALDVEIATYR;FASFIDK;LAELEEALQK;QNLEPLFEQYINNLR;SFSTASAITPSVSR;VDALMDEINFMK;WTLLQEQGTK;YEELQQTAGR;EYQELMNTK;GLGVGFGSGGGSSSSVK) 1.68E-02 (FASFIDK;NLDLDSIIAEVK;QNLEPLFEQYINNLR;LAELEEALQK;LALDVEIATYR) 2 IPI00796776.1, IPI00009867.2
519 IPI00009883.1 Cytochrome P450 39A1 ER(SP,GO) - - - 2.70E-02 (DNSMTLLQATLDIVETETSK;AIMEGISSVFGK) - - 2 IPI00009883.1, IPI00745596.1
520 IPI00009885.1 FK506-binding protein 11 precursor ER(G1) - - - 7.18E-01 (DPLVIELGQK;IIDTSLTRDPLVIELGQK;AIIPSHLAYGK) 4.08E-01 (GFPPSVPADAVVQYDVELIALIR;AIIPSHLAYGK;DPLVIELGQK) - 2 IPI00009885.1, IPI00791084.1
521 IPI00009896.1 Epoxide hydrolase 1 ER(G1) 1.15E+01 (DKEETLPLEDGWWGPGTR;EDDSIRPFKVETSDEEIHDLHQR;EETLPLEDGWWGPGTR;FTPPLEDSCFHYGFNSNYLK;IEGLDIHFIHVK;IEGLDIHFIHVKPPQLPAGHTPK;PLLMVHGWPGSFYEFYK;TKIEGLDIHFIHVKPPQLPAGHTPK;VETSDEEIHDLHQR;PPQLPAGHTPKPL 2.21E+00 (IEGLDIHFIHVKPPQLPAGHTPK;PLLMVHGWPGSFYEFYK;TKIEGLDIHFIHVKPPQLPAGHTPK;VETSDEEIHDLHQR;DKEETLPLEDGWWGPGTR;EDDSIRPFKVETSDEEIHDLHQR;FTPPLEDSCFHYGFNSNYLK;FLSVLER;FSTWTNTEFR;IIPLLTDPK;NHGLSDEHVFEVIC 3.17E+00 (FLSVLER;IEGLDIHFIHVKPPQLPAGHTPK;IIPLLTDPK;NHGLSDEHVFEVICPSIPGYGFSEASSK;PDTVGSALNDSPVGLAAYILEK;PLLMVHGWPGSFYEFYK;TKIEGLDIHFIHVKPPQLPAGHTPK;VETSDEEIHDLHQR;VYVPTGFSAFPFELLHTPEK;DKEETLPLEDGWWGPG 3.17E+01 (DKEETLPLEDGWWGPGTR;EDDSIRPFKVETSDEEIHDLHQR;EETLPLEDGWWGPGTR;IEGLDIHFIHVK;IEGLDIHFIHVKPPQLPAGHTPK;TKIEGLDIHFIHVKPPQLPAGHTPK;PLLMVHGWPGSFYEFYK;TKIEGLDIHFIHVK;VETSDEEIHDLHQR;FTPPLEDSCFHYGFNSNYL 5.74E+01 (DKEETLPLEDGWWGPGTR;EDDSIRPFKVETSDEEIHDLHQR;EETLPLEDGWWGPGTR;IEGLDIHFIHVKPPQLPAGHTPK;PFKVETSDEEIHDLHQR;PLLMVHGWPGSFYEFYK;TKIEGLDIHFIHVKPPQLPAGHTPK;VETSDEEIHDLHQR;VISYWR;VYVPTGFSAFPFELLHTPEK;D 6.85E+00 (EETLPLEDGWWGPGTR;IEGLDIHFIHVKPPQLPAGHTPK;TKIEGLDIHFIHVKPPQLPAGHTPK;VETSDEEIHDLHQR;DKEETLPLEDGWWGPGTR;EDDSIRPFKVETSDEEIHDLHQR;FTPPLEDSCFHYGFNSNYLK;FRFTPPLEDSCFHYGFNSNYLK;PLLMVHGWPGSFYEFYK;FLS 1 IPI00009896.1
522 IPI00009904.1 Protein disulfide-isomerase A4 precursor ER(SP) 1.26E+00 (DFPEYTFAIADEEDYAGEVK;DLGLSESGEDVNAAILDESGK;EVSQPDWTPPPEVTLVLTK;FDVSGYPTIK;FHHTFSTEIAK;GESDPAYQQYQDAANNLR;IDATSASVLASR;YGIVDYMIEQSGPPSK;RFDVSGYPTLK;DGDDVIIIGVFK;VDATAETDLAK;GRPYDYNGPR;VSQGQLV 3.17E-01 (DFPEYTFAIADEEDYAGEVK;DLGLSESGEDVNAAILDESGKK;FEGGDRDLEHLSK;GESDPAYQQYQDAANNLR;IDATSASVLASR;VDATAETDLAK;VDATAETDLAKR;VEGFPTIYFAPSGDK;VEGFPTIYFAPSGDKK;VSQGQLVVMQPEK;YGIVDYMIEQSGPPSK;EVSQPDWTPPP - 1.48E+01 (YGIVDYMIEQSGPPSK;DFPEYTFAIADEEDYAGEVK;DGDDVIIIGVFK;DGDDVIIIGVFKGESDPAYQQYQDAANNLR;DLGLSESGEDVNAAILDESGK;DLGLSESGEDVNAAILDESGKK;EDYKFHHTFSTEIAK;EENGVLVLNDANFDNFVADK;EFVTAFK;EKYGIVDYMIEQSGPPSK 1.12E+01 (DFPEYTFAIADEEDYAGEVK;DGDDVIIIGVFK;DLGLSESGEDVNAAILDESGK;DLGLSESGEDVNAAILDESGKK;EDYKFHHTFSTEIAK;EENGVLVLNDANFDNFVADK;EFVTAFK;EKYGIVDYMIEQSGPPSK;ENAIEDEEEEEEEDDDEEEDDLEVK;EVSQPDWTPPPEVTLVLTK;F 1.94E-01 (DFPEYTFAIADEEDYAGEVK;DLGLSESGEDVNAAILDESGKK;GESDPAYQQYQDAANNLR;IDATSASVLASR;VEGFPTIYFAPSGDK;YGIVDYMIEQSGPPSK;EVSQPDWTPPPEVTLVLTK;YKVEGFPTIYFAPSGDK;YALPLVGHR) 1 IPI00009904.1
523 IPI00009920.2 Complement component C6 precursor ER(G1) - 9.30E-03 (ENPAVIDFELAPIVDLVR;VPANLENVGFEVQTAEDDLKTDFYK) - 1.97E-02 (ALNHLPLEYNSALYSR;ENPAVIDFELAPIVDLVR;VPANLENVGFEVQTAEDDLKTDFYK) 4.94E-02 (ENPAVIDFELAPIVDLVR;VPANLENVGFEVQTAEDDLKTDFYK;ALNHLPLEYNSALYSR) 2.51E-02 (IFDDFGTHYFTSGSLGGVYDLLYQFSSEELK;VPANLENVGFEVQTAEDDLKTDFYK) 1 IPI00009920.2
524 IPI00009923.1 Isoform 1 of Prolyl 4-hydroxylase alpha-1 subunit precursor ER(SP,GO); Mito(GO) - - - 2.46E-01 (FHDIISDAEIEIVK;GVAVDYLPER;LNTEWSELENLVLK;LQDTYNLDTDTISK;VSVLDYLSYAVYQQGDLDK;DPEGFVGHPVNAFK;QYFPNDEDQVGAAK) 1.95E-01 (DPEGFVGHPVNAFK;FHDIISDAEIEIVK;IQDLTGLDVSTAEELQVANYGVGGQYEPHFDFAR;LNTEWSELENLVLK;VSVLDYLSYAVYQQGDLDK;SAWLSGYENPVVSR;GVAVDYLPER) - 2 IPI00009923.1, IPI00218682.1
525 IPI00009931.3 Haloacid dehalogenase-like hydrolase domain containing 3 Mito(G1,MitoP2) - 1.78E-01 (AHGLEVEPSALEQGFR;AQSHSFPNYGLSHGLTSR;EHILPSLAHLLPALDCLEGSTPGL) 1.70E+00 (DFSHPCTWQVLDGAEDTLR;EHILPSLAHLLPALDCLEGSTPGL;AHGLEVEPSALEQGFR;AQSHSFPNYGLSHGLTSR;LAHMEPVVAAHVGDNYLCDYQGPR;LAVISNFDR;LEGILGGLGLR;EHFDFVLTSEAAGWPKPDPR) - - - 1 IPI00009931.3
526 IPI00009949.1 Proteasome inhibitor PI31 subunit Cyto(G1,HPA) - 1.01E-01 (ALIDPSSGLPNR;IVSGIITPIHEQWEK;DLYVLR;LPPGAVPPGAR) - - - - 2 IPI00009949.1, IPI00643536.2
527 IPI00009950.1 Vesicular integral-membrane protein VIP36 precursor ER(G1,SP) 2.80E+00 (DNFHGLAIFLDTYPNDETTER;DNVDDPTGNFR;IEPSVNFLK;LFQLMVEHTPDEESIDWTK;LPTGYYFGASAGTGDLSDNHDIISMK;NCIDITGVR;NLHGDGIALWYTR;WTELAGCTADFR) - - 4.82E+00 (DHDTFLAVR;DNFHGLAIFLDTYPNDETTER;DNVDDPTGNFR;IEPSVNFLK;LFQLMVEHTPDEESIDWTK;LPTGYYFGASAGTGDLSDNHDIISMK;LTVMTDLEDKNEWK;LVPGPVFGSK;NLHGDGIALWYTR;SPKDNVDDPTGNFR;LTVMTDLEDK;DWEMHVHFK) 8.24E+00 (DHDTFLAVR;DNFHGLAIFLDTYPNDETTER;DNVDDPTGNFR;EHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVR;LPTGYYFGASAGTGDLSDNHDIISMK;IEPSVNFLK;LFQLMVEHTPDEESIDWTK;LTVMTDLEDK;LTVMTDLEDKNEWK;NLHGDGIALWYTR;LVPGPVFGSK;DWEM 5.05E-01 (DNFHGLAIFLDTYPNDETTER;DNVDDPTGNFR;NLHGDGIALWYTR;WTELAGCTADFR;NCIDITGVR;IEPSVNFLK) 1 IPI00009950.1
528 IPI00009958.5 COP9 signalosome complex subunit 5 Cyto(SP); Nucl(SP,GO,HPA) 1.01E-01 (GSFMLGLETHDR;QQQEILAAK) - - - - - 1 IPI00009958.5
529 IPI00009976.1 Transmembrane emp24 domain-containing protein 1 precursor ER(G1) - - - 1.56E+00 (KADGVHTVEPTEAGDYK;MEDIKESIETMR;SIQMLTLLR;ADGVHTVEPTEAGDYK) 1.25E+00 (KADGVHTVEPTEAGDYK;MEDIKESIETMR;SIQMLTLLR;ADGVHTVEPTEAGDYK) 1.24E-01 (KADGVHTVEPTEAGDYK;ADGVHTVEPTEAGDYK) 1 IPI00009976.1
530 IPI00010080.2 Serine/threonine-protein kinase OSR1 Cyto(G2) - 1.79E-02 (SGVLDESTIATILR;EVLEGLEYLHK) - - - - 1 IPI00010080.2
531 IPI00010090.1 Glutamate--cysteine ligase regulatory subunit Cyto(G1,GO) - 1.29E-01 (LFIVESNSSSSTR;EFPDVLECTVSHAVEK;TLHLQTGNLLNWGR;IVAIGTSDLDK) - - - - 1 IPI00010090.1
532 IPI00010105.1 Eukaryotic translation initiation factor 6 Cyto(SP); Nucl(SP) - 1.13E+00 (LTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCR;ASFENNCEIGCFAK;HGLLVPNNTTDQELQHIR;NSLPDTVQIR;TSIEDQDELSSLLQVPLVAGTVNR;QTVADQVLVGSYCVFSNQGGLVHPK;LSALGNVTTCNDYVALVHPDLDRETEEILADVLK;LSALGNVTTCNDYVALVHP 1.24E-01 (HGLLVPNNTTDQELQHIR;LSALGNVTTCNDYVALVHPDLDRETEEILADVLK) - 9.49E-02 (HGLLVPNNTTDQELQHIR;LNEAQPSTIATSMR) 1.74E+00 (TSIEDQDELSSLLQVPLVAGTVNR;ASFENNCEIGCFAK;HGLLVPNNTTDQELQHIR;NSLPDTVQIR;LSALGNVTTCNDYVALVHPDLDRETEEILADVLK) 1 IPI00010105.1
533 IPI00010130.2 Glutamine synthetase Cyto(G1,SP,GO,HPA) - 3.24E-01 (LVLCEVFK;LTGFHETSNINDFSAGVANR;RLTGFHETSNINDFSAGVANR;RPSANCDPFSVTEALIR;TCLLNETGDEPFQYKN;VCEDFGVIATFDPKPIPGNWNGAGCHTNFSTK;QVYMSLPQGEK) - - 4.09E-02 (RLTGFHETSNINDFSAGVANR;LTGFHETSNINDFSAGVANR) 4.85E-02 (LTGFHETSNINDFSAGVANR;RLTGFHETSNINDFSAGVANR) 1 IPI00010130.2
534 IPI00010133.2 Coronin-1A Cyto(G1,GO); Nucl(G1,GO); PM(GO) - 1.33E-01 (FVALICEASGGGAFLVLPLGK;HLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGK;DAGPLLISLK;KSDLFQEDLYPPTAGPDPALTAEEWLGGR;ILTTGFSR) - - - 1.29E-01 (HLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGK;KSDLFQEDLYPPTAGPDPALTAEEWLGGR) 1 IPI00010133.2
535 IPI00010153.5 60S ribosomal protein L23 Cyto(G1,GO,HPA); Mito(MitoP2) - 4.76E-01 (DGVFLYFEDNAGVIVNNK;ISLGLPVGAVINCADNTGAK;LPAAGVGDMVMATVKK) - 2.62E-01 (DGVFLYFEDNAGVIVNNK;LPAAGVGDMVMATVK) - - 4 IPI00010153.5, IPI00742805.1, IPI00791920.1, IPI00795408.1
536 IPI00010154.3 Rab GDP dissociation inhibitor alpha Cyto(G1,GO) - 6.56E-01 (FDLGQDVIDFTGHALALYR;KFDLGQDVIDFTGHALALYR;NTNDANSCQIIIPQNQVNR;SPYLYPLYGLGELPQGFAR;FLMANGQLVK;MLLYTEVTR;FLVFVANFDENDPK;NPYYGGESSSITPLEELYK;VPSTETEALASNLMGMFEK;QLICDPSYIPDR;SDIYVCMISYAHNVAAQGK; - 2.95E-02 (DIYKRMAGTAFDFENMK;VVEGSFVYKGGKIYK) 3.39E-02 (FDLGQDVIDFTGHALALYR;SPYLYPLYGLGELPQGFAR;MLLYTEVTR;VPSTETEALASNLMGMFEK) 3.75E-02 (FDLGQDVIDFTGHALALYR;SPYLYPLYGLGELPQGFAR;FQLLEGPPESMGRGR) 1 IPI00010154.3
537 IPI00010157.1 S-adenosylmethionine synthetase isoform type-2 Cyto(G1,GO) - 3.05E-01 (IIVDTYGGWGAHGGGAFSGK;KIIVDTYGGWGAHGGGAFSGK;NFDLRPGVIVR;TCNVLVALEQQSPDIAQGVHLDR;TQVTVQYMQDR;YLDEDTIYHLQPSGR;FVIGGPQGDAGLTGR;NGTLPWLRPDSK) - - - - 1 IPI00010157.1
538 IPI00010190.3 Isoform 1 of Peroxisomal 2,4-dienoyl-CoA reductase Mito(G2) 6.86E-02 (APPAVMAAVDQALK;VNSLAPGPISGTEGLR) - - 1.24E-01 (TVMDIDTSGTFNVSR;VAFITGGGSGIGFR;VNSLAPGPISGTEGLR;APPAVMAAVDQALK) - - 2 IPI00010190.3, IPI00795726.1
539 IPI00010196.1 Nuclear receptor-interacting protein 1 Nucl(SP,GO) - 1.20E-02 (PESGLLNGCSMPSEK;DVGSYQLPKGMSSHLNGQAR;AFSSQPTGPEPGLSGSEIENLLERR) - 1.13E-02 (FAESPHHVGQSGTK;PHSANGEVYGLLGSVLTIKK) 1.21E-02 (DVGSYQLPKGMSSHLNGQARTSSSK;QDSTLLASLLQSFSSR) - 1 IPI00010196.1
540 IPI00010201.4 40 kDa protein Cyto(G1,GO,HPA); Nucl(GO,HPA) - 1.78E-01 (DILEIGAQWSILR;VAEFHTELER;DIQTNVYIK;LVLLELNFLPTTGTK;GWVLGPNNYYSFASQQQKPEDTTIPSTELAK) - - - - 2 IPI00791437.1, IPI00010201.4
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home