Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
541 IPI00010204.1 Splicing factor, arginine/serine-rich 3 Nucl(SP,GO) - 2.12E-01 (NPPGFAFVEFEDPR;AFGYYGPLR) - 1.08E-01 (AFGYYGPLR;NPPGFAFVEFEDPR) - 3.68E+00 (VYVGNLGNNGNKTELER;AFGYYGPLR;NPPGFAFVEFEDPR;NPPGFAFVEFEDPRDAADAVR) 2 IPI00215802.1, IPI00010204.1
542 IPI00010218.1 Cytochrome P450 monooxygenase ER(G2) - - - 3.54E-02 (FAYMVTTVLLSVLVK;FDPDRFDDELVMK;LHLLSVEGQVIETK;LYEEINQVFGNGPVTPEK;DGNLPDIVNSGSLHEFLVNLHER;ETLVLYALGVVLQDPNTWPSPHK;TFSSLGFSGTQECPELR;TLDPFETMLK) 4.92E-02 (ETLVLYALGVVLQDPNTWPSPHK;LHLLSVEGQVIETK;LYEEINQVFGNGPVTPEK;SVTQMVMGSTFEDDQEVIR;YGPVVSFWFGR;FDPDRFDDELVMK;LSEELLDK;LYENGVTDSLK;FAYMVTTVLLSVLVK;TLDPFETMLK) - 1 IPI00010218.1
543 IPI00010248.3 Maspardin Cyto(SP,GO,HPA); Nucl(HPA) - 4.30E-02 (DIPVTIMDVFDQSALSTEAK;LESLGQSELASR;CPLIFLPPVSGTADVFFR) - - - - 1 IPI00010248.3
544 IPI00010270.1 Ras-related C3 botulinum toxin substrate 2 precursor Cyto(SP,GO); PM(GO) - 9.01E-01 (CVVVGDGAVGK;TVFDEAIR;YLECSALTQR;LDLRDDKDTIEK;KLAPITYPQGLALAK;LAPITYPQGLALAK;HHCPSTPIILVGTK;LRPLSYPQTDVFLICFSLVSPASYENVR;AVLCPQPTRQQK) - - 2.86E-01 (KLAPITYPQGLALAK;LAPITYPQGLALAK;PVNLGLWDTAGQEDYDR;LDLRDDKDTIEK) - 1 IPI00010270.1
545 IPI00010271.3 Isoform A of Ras-related C3 botulinum toxin substrate 1 precursor Cyto(G1,GO); PM(GO) 4.70E-01 (PVNLGLWDTAGQEDYDR;LTPITYPQGLAMAKEIGAVK;YLECSALTQR) 1.25E+00 (CVVVGDGAVGK;LRPLSYPQTDVFLICFSLVSPASFENVR;WYPEVR;LTPITYPQGLAMAK;HHCPNTPIILVGTK;AVLCPPPVK;TVFDEAIR;YLECSALTQR;LDLRDDKDTIEK) - 2.02E-01 (KLTPITYPQGLAMAK;LTPITYPQGLAMAK) 3.98E-01 (PVNLGLWDTAGQEDYDR;LDLRDDKDTIEK;KLTPITYPQGLAMAK;LTPITYPQGLAMAK) - 1 IPI00010271.3
546 IPI00010290.2 FABP1 protein (Fragment) Cyto(SP) - 6.22E+00 (AIGLPEELIQK;VIQNEFTVGEECELETMTGEK;YQLQSQENFEAFMK;SVTELNGDIITNTMTLGDIVFK;SVTELNGDIITNTMTLGDIVFKR) - 5.30E-01 (SVTELNGDIITNTMTLGDIVFK;YQLQSQENFEAFMK;AIGLPEELIQK) 2.75E+00 (AIGLPEELIQK;YQLQSQENFEAFMK;SVTELNGDIITNTMTLGDIVFK) 5.62E-01 (AIGLPEELIQK;SVTELNGDIITNTMTLGDIVFK) 1 IPI00010290.2
547 IPI00010314.5 Delta-aminolevulinic acid dehydratase Cyto(G1,GO) - 3.09E+00 (MQPQSVLHSGYFHPLLR;AAVLEAMTAFR;AGCQVVAPSDMMDGR;DKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLK;FASCFYGPFR;RLEEMLRPLVEEGLR;TFPNLLVACDVCLCPYTSHGHCGLLSENGAFR;AGADIIITYYTPQLLQWLK;AWQTATTTLNASNLIYPIFVTDVPDDIQPIT - 1.08E-01 (AAVLEAMTAFR;GSAADSEESPAIEAIHLLR;LAEVALAYAK) 2.78E-01 (AAVLEAMTAFR;EGADMLMVKPGMPYLDIVR;GSAADSEESPAIEAIHLLR;LAEVALAYAK;LEEMLRPLVEEGLR) 1.37E-01 (LAEVALAYAK;GSAADSEESPAIEAIHLLR) 1 IPI00010314.5
548 IPI00010320.1 Chromobox protein homolog 1 Nucl(SP,GO) - 1.28E-01 (IIGATDSSGELMFLMK;CPQVVISFYEER;KKVEEVLEEEEEEYVVEK) - - - 3.37E-01 (CPQVVISFYEER;KKVEEVLEEEEEEYVVEK;KVEEVLEEEEEEYVVEK;VEEVLEEEEEEYVVEK) 1 IPI00010320.1
549 IPI00010331.1 Isoform 2 of NAD-dependent deacetylase sirtuin-5 Cyto(G1); Mito(SP,GO) - 1.32E-01 (GAPEPGTQDASIPVEK;NLLEIHGSLFK;GVPVAEFNTETTPATNR;RVVVITQNIDELHR;VVVITQNIDELHR) 3.88E-02 (NLLEIHGSLFK;GAPEPGTQDASIPVEK) 6.20E-02 (GAPEPGTQDASIPVEK;NLLEIHGSLFK) 4.44E-02 (GAPEPGTQDASIPVEK;FSHLISISSLIIIKN) - 1 IPI00010331.1
550 IPI00010339.3 6-pyruvoyl tetrahydrobiopterin synthase Cyto(G2,GO); Mito(GO) - 8.26E-02 (VYETDNNIVVYK;VYETDNNIVVYKGE) - - - - 1 IPI00010339.3
551 IPI00010346.1 Neurolysin, mitochondrial precursor Cyto(G1); Mito(MitoP2) - 1.02E-01 (AELGALPDDFIDSLEK;ATGEVLGQFYLDLYPR;DKATGEVLGQFYLDLYPR;NLNEDDTFLVFSK;IVHLQETCDLGK;CKEENTIILQQLLPLR;EFILNLKK;EFILNLK;MSELCIDFNKNLNEDDTFLVFSK) - - - - 1 IPI00010346.1
552 IPI00010349.1 Alkyldihydroxyacetonephosphate synthase, peroxisomal precursor PM(G1,GO) 2.01E-01 (ASLNPSDTPPSVVNEDFLHDLK;ETNISYSQEADDR;GFDPNQLSVATLLFEGDR;GISDPLTVFEQTEAAAR;NIYGNIEDLVVHIK) - - - - - 1 IPI00010349.1
553 IPI00010351.1 Isoform I of Macrophage scavenger receptor types I and II Cyto(G2); PM(GO) - - - - 1.19E-01 (FNDILLQLSTLFSSVQGHGNAIDEISK;EEQVHLEQEIKGEVKVLNNITNDLR) - 3 IPI00010351.1, IPI00012740.1, IPI00071002.1
554 IPI00010353.1 Isoform 1 of UBX domain-containing protein 6 ER(G1) - - - 2.05E-01 (EIPDLPEEPSQTAEEVVTVALR;LGGDEGTSQTSFETSNR;LSSGHKLGGDEGTSQTSFETSNR;YIENVLKPHQEMK;SPQVYLKEEEEKNEK) 1.65E-01 (LGGDEGTSQTSFETSNR;EIPDLPEEPSQTAEEVVTVALR;ILLLLALLTLIISVTTSWLNSFK) - 1 IPI00010353.1
555 IPI00010397.4 HLA class II DR-beta (HLA-DR B) precursor ER(G1,SP); PM(SP,GO) - - - 1.90E-01 (AVTELGRPDAEYWNSQK;FDSDVGEYR;HNYGVVESFTVQR;YFYHQEEYVR) 5.89E-01 (AVTELGRPDAEYWNSQK;HNYGVVESFTVQR;FDSDVGEYR;YFYHQEEYVR;RVYPEVTVYPAK) - 1 IPI00010397.4
556 IPI00010404.1 Splicing factor 3B subunit 5 Nucl(G1,GO) - - - - - 9.52E-01 (YTIHSQLEHLQSK;WEWLVNQHR) 1 IPI00010404.1
557 IPI00010414.3 PDZ and LIM domain protein 1 Cyto(G1) - 6.00E-01 (AALANLCIGDVITAIDGENTSNMTHLEAQNR;VITNQYNNPAGLYSSENISNFNNALESK;DFEQPLAISR;GCTDNLTLTVAR;QSTSFLVLQEILESEEK;TAASGVEANSRPLDHAQPPSSLVIDK;TAASGVEANSRPLDHAQPPSSLVIDKESEVYK;VWSPLVTEEGKR;IKGCTDNLTLTVAR - - - - 1 IPI00010414.3
558 IPI00010420.2 Hypothetical protein DKFZp434N1235 Mito(SP,GO,MitoP2,HPA) - 3.38E-02 (VKLLLQVQASSKQISPEAR;YFPTQALNFAFK;RMMMQSGEAKR) - - - 3.55E-02 (YFPTQALNFAFK;VKLLLQVQASSKQISPEAR) 1 IPI00010420.2
559 IPI00010438.2 Isoform SNAP-23a of Synaptosomal-associated protein 23 PM(SP,GO,HPA); Nucl(GO,HPA) - - - - 3.95E-01 (AHQITDESLESTR;IEEGLDQINK;ILGLAIESQDAGIK;ITNDAREDEMEENLTQVGSILGNLK;EDEMEENLTQVGSILGNLK) - 1 IPI00010438.2
560 IPI00010460.1 AH receptor-interacting protein Cyto(G1,SP,GO,HPA); Nucl(GO,HPA) - 1.24E-01 (TLHSDDEGTVLDDSR;GELPDFQDGTK) - 3.19E-02 (TLHSDDEGTVLDDSRARGK;EHSSLGHADLDALQQNPQPLIFHMEMLK) - 4.06E-02 (TLHSDDEGTVLDDSR;VLELDPALAPVVSR) 1 IPI00010460.1
561 IPI00010463.5 GTP binding protein 1 Nucl(G2) - - - - 2.32E-02 (EEEPAEFQIDDTYSVPGVGTVVSGTTLR;LVLVSPTSEQYDSLLR) - 1 IPI00010463.5
562 IPI00010471.4 Plastin-2 Cyto(G1,SP,GO,HPA); PM(GO,HPA) - 1.55E+00 (AACLPLPGYR;EGICAIGGTSEQSSVGTQHSYSEEEK;EGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINK;EGKPYLVLGLLWQVIK;IGLFADIELSR;LTPFTIQENLNLALNSASAIGCHVVNIGAEDLK;MINLSVPDTIDER;VDTDGNGYISFNELNDLFK;HVIPMNPNTNDLFNAVGDG - 1.89E-02 (IGNFSTDIK;LNLAFIANLFNR) 5.07E-02 (ISTSLPVLDLIDAIQPGSINYDLLK;LNLAFIANLFNR;VNHLYSDLSDALVIFQLYEK;IGNFSTDIK) 3.48E-01 (EGKPYLVLGLLWQVIK;VDTDGNGYISFNELNDLFK;FSLVGIGGQDLNEGNR;ISTSLPVLDLIDAIQPGSINYDLLK;VNHLYSDLSDALVIFQLYEK;AYYHLLEQVAPK;YPALHKPENQDIDWGALEGETR;VYALPEDLVEVNPK) 1 IPI00010471.4
563 IPI00010490.1 Isoform Long of Armadillo repeat protein deleted in velo-cardio-facial syndrome Nucl(G1) - - - - 1.36E-02 (ECEGLVDALLHALQSAVGRK;GASSAGEASEKEPLK) 3.24E-02 (GLPLLVALLDHPR;DLIGSYAMAELVRNVR;YQEAEPGPLGSAVGSQRRR;FERLTRALEQER) 1 IPI00010490.1
564 IPI00010527.2 solute carrier family 22 member 7 isoform b PM(G1,SP,GO) 1.15E-01 (LGGSLAPLAALLDGVWLSLPK;VLLPLHFLLPIFLAAVPAHR;NVALLALPR) - - - - - 3 IPI00010527.2, IPI00477953.1, IPI00644268.1
565 IPI00010604.4 Isoform 1 of 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase epsilon 1 Nucl(G2); Cyto(SP,GO,HPA); PM(SP,GO) - - - 6.09E-03 (ISVGPCLKQCVRDTVCEYR;GYRHLQLRNLHNEVLEISSLFINSR) - - 4 IPI00010604.4, IPI00307660.4, IPI00749412.1, IPI00791109.1
566 IPI00010697.1 Isoform Alpha-6X1X2B of Integrin alpha-6 precursor PM(SP,GO) - - - - 1.18E-02 (SEDEVGSLIEYEFR;VNSLPEVLPILNSDEPK) - 6 IPI00010697.1, IPI00216221.1, IPI00216222.1, IPI00216223.1, IPI00216224.1, IPI00216225.1
567 IPI00010700.2 Isoform 1 of Large proline-rich protein BAT2 Cyto(SP); Nucl(SP) - - - 4.93E-03 (VAIARRMPPPANLPSLK;EEFPTLQAAGDQDK) 7.05E-03 (KGNSPNSEPPTPKTAWAETSR;GVGSGGQGPPPPR) - 2 IPI00010700.2, IPI00084746.2
568 IPI00010706.1 Glutathione synthetase Cyto(G1,GO) - 4.62E-01 (AIEHADGGVAAGVAVLDNPYPV;AWELYGSPNALVLLIAQEK;CPDIATQLAGTK;CPDIATQLAGTKK;EGIAQTVFLGLNR;QIEINTISASFGGLASR;AIENELLAR;ALAEGVLLR;ATFAGLYSLDVGEEGDQAIAEALAAPSR;LFVDGQEIAVVYFR;VVQCISELGIFGVYVR) - - - - 1 IPI00010706.1
569 IPI00010717.1 Mevalonate kinase Cyto(G1,SP,GO,HPA) - 1.90E-01 (FPEIVAPLLTSIDAISLECER;SPALQILLTNTK;LKEVAGLPDDCAVTER;LTGAGGGGCGITLLKPGLEQPEVEATK;QALTSCGFDCLETSIGAPGVSIHSATSLDSR;VDLSLPNIGIK) - 1.03E-01 (SPALQILLTNTK;VDLSLPNIGIK;PGLEQPEVEATK) - - 1 IPI00010717.1
570 IPI00010720.1 T-complex protein 1 subunit epsilon Cyto(G1,SP,GO); Nucl(GO) 6.65E-02 (LGFAGLVQEISFGTTK;WVGGPEIELIAIATGGR) 2.27E-01 (HKLDVTSVEDYK;IAILTCPFEPPKPK;ISDSVLVDIKDTEPLIQTAK;LDVTSVEDYK;LGFAGLVQEISFGTTK;SQDDEIGDGTTGVVVLAGALLEEAEQLLDR;WVGGPEIELIAIATGGR) - 2.00E-02 (LGFAGLVQEISFGTTK;WVGGPEIELIAIATGGR) 2.15E-02 (LGFAGLVQEISFGTTK;WVGGPEIELIAIATGGR) 2.42E-01 (HKLDVTSVEDYK;LGFAGLVQEISFGTTK;WVGGPEIELIAIATGGR) 1 IPI00010720.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home