Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
31 IPI00000792.1 Quinone oxidoreductase Cyto(SP,GO) 1.61E-01 (VFTSSTISGGYAEYALAADHTVYK;VFEFGGPEVLK;QGAAIGIPYFTAYR;KPLLPYTPGSDVAGVIEAVGDNASAFK) 2.24E+00 (AGESVLVHGASGGVGLAACQIAR;EEFQQYAAALQAGMEIGWLKPVIGSQYPLEK;ESSIIGVTLFSSTK;IVLQNGAHEVFNHR;PVIGSQYPLEK;QGAAIGIPYFTAYR;VHACGVNPVETYIR;KPLLPYTPGSDVAGVIEAVGDNASAFK;KPLLPYTPGSDVAGVIEAVGDNASAFKK;SDIAV 4.15E+00 (AGESVLVHGASGGVGLAACQIAR;EEFQQYAAALQAGMEIGWLKPVIGSQYPLEK;ESSIIGVTLFSSTK;KPLLPYTPGSDVAGVIEAVGDNASAFK;IVLQNGAHEVFNHR;PVIGSQYPLEK;QGAAIGIPYFTAYR;VHACGVNPVETYIR;VFTSSTISGGYAEYALAADHTVYK;KPLLPYTPG 4.67E-01 (DLSLLSHGGR;ESSIIGVTLFSSTK;IVLQNGAHEVFNHR;KPLLPYTPGSDVAGVIEAVGDNASAFK;QGAAIGIPYFTAYR;SDIAVPIPK;VFEFGGPEVLK;VFTSSTISGGYAEYALAADHTVYK) 7.10E-01 (DLSLLSHGGR;ESSIIGVTLFSSTK;IVLQNGAHEVFNHR;KPLLPYTPGSDVAGVIEAVGDNASAFK;SDIAVPIPK;VFEFGGPEVLK;VFTSSTISGGYAEYALAADHTVYK;QGAAIGIPYFTAYR) 4.36E+00 (AGESVLVHGASGGVGLAACQIAR;ESSIIGVTLFSSTK;IVLQNGAHEVFNHR;QGAAIGIPYFTAYR;VHACGVNPVETYIR;KPLLPYTPGSDVAGVIEAVGDNASAFK;KPLLPYTPGSDVAGVIEAVGDNASAFKK;SDIAVPIPK;VFEFGGPEVLK;VFTSSTISGGYAEYALAADHTVYK;PV 1 IPI00000792.1
32 IPI00000811.2 Proteasome subunit beta type 6 precursor Cyto(SP); Nucl(SP) - 1.16E+00 (LAAIAESGVER;SGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFK) - - 1.61E-01 (LAAIAESGVER;SGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFK) 1.57E+00 (LAAIAESGVER;SGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFK) 1 IPI00000811.2
33 IPI00000816.1 14-3-3 protein epsilon Cyto(G1,GO,HPA) - 2.71E+00 (AAFDDAIAELDTLSEESYK;AAFDDAIAELDTLSEESYKDSTLIMQLLR;AASDIAMTELPPTHPIR;DSTLIMQLLR;EAAENSLVAYK;EALQDVEDENQ;KVAGMDVELTVEER;LICCDILDVLDK;LICCDILDVLDKHLIPAANTGESK;VAGMDVELTVEER;NLLSVAYK;NLLSVAYKNVI - 1.29E-01 (AAFDDAIAELDTLSEESYK;AAFDDAIAELDTLSEESYKDSTLIMQLLR;YLAEFATGNDR;DSTLIMQLLR;NLLSVAYK) 1.03E+00 (AAFDDAIAELDTLSEESYK;AAFDDAIAELDTLSEESYKDSTLIMQLLR;AASDIAMTELPPTHPIR;DSTLIMQLLR;EAAENSLVAYK;YLAEFATGNDR;YLAEFATGNDRK;NLLSVAYK;VAGMDVELTVEER) 3.71E-01 (AAFDDAIAELDTLSEESYK;LICCDILDVLDK;YLAEFATGNDR;NLLSVAYK) 1 IPI00000816.1
34 IPI00000856.7 Isoform 1 of Pleckstrin homology domain-containing family C member 1 Cyto(G2,SP,GO); Nucl(HPA) - 5.06E-02 (KEELIGIAYNR;KLDDQSEDEALELEGPLITPGSGSIYSSPGLYSK;TSTILGDITSIPELADYIK;GCEVTPDVNISGQK;FIQAWQSLPEFGITHFIAR;YYSFFDLNPK) - - 2.93E-02 (TMADSSYNLEVQNILSFLK;VTGEVHIGGVMLKLVEK) - 2 IPI00383500.1, IPI00000856.7
35 IPI00000858.1 Isoform 1 of Negative elongation factor E Nucl(G2,SP,GO,HPA); Mito(GO,HPA) - - - 6.37E-02 (DREGPFR;QSSSSTTSQGGVK) - - 4 IPI00000858.1, IPI00154408.4, IPI00793755.1, IPI00795111.1
36 IPI00000873.3 Valyl-tRNA synthetase Cyto(G1,GO) - 5.14E-01 (ADFPAGIPECGTDALR;SLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVEK;EVYLHAIVR;IPAYFVTVSDPAVPPGEDPDGR;GFVPSPTSQPGGHESLVDR;ITPAHDQNDYEVGQR;LSAAVTEAFVR;RDPGVITYDLPTPPGEK;VQGSDSDEEVVVATTR;AVLGEVVLYSGAR;CGEMAQ - - - - 1 IPI00000873.3
37 IPI00000874.1 Peroxiredoxin-1 Nucl(G1,GO); Mito(GO,HPA); Cyto(SP,GO) 1.19E+00 (GLFIIDDK;LVQAFQFTDK;QITVNDLPVGR;TIAQDYGVLK) 3.25E+00 (ATAVMPDGQFK;KLNCQVIGASVDSHFCHLAWVNTPK;KQGGLGPMNIPLVSDPK;LNCQVIGASVDSHFCHLAWVNTPK;QGGLGPMNIPLVSDPK;GLFIIDDK;LVQAFQFTDK;QITVNDLPVGR;TIAQDYGVLK;DISLSDYK;HGEVCPAGWKPGSDTIKPDVQK) - 1.16E+00 (ATAVMPDGQFK;GLFIIDDK;GLFIIDDKGILR;KQGGLGPMNIPLVSDPK;LVQAFQFTDK;QITVNDLPVGR;TIAQDYGVLK;QGGLGPMNIPLVSDPK;DISLSDYK) 3.70E+00 (ATAVMPDGQFK;GLFIIDDK;KQGGLGPMNIPLVSDPK;LVQAFQFTDK;QGGLGPMNIPLVSDPK;QITVNDLPVGR;TIAQDYGVLK;DISLSDYK) 2.01E+01 (QITVNDLPVGR;HGEVCPAGWKPGSDTIKPDVQK;GLFIIDDK;GLFIIDDKGILR;LVQAFQFTDK;GKYVVFFFYPLDFTFVCPTEIIAFSDR;KLNCQVIGASVDSHFCHLAWVNTPK;LNCQVIGASVDSHFCHLAWVNTPK;RTIAQDYGVLK;TIAQDYGVLK;DISLSDYK;QGGLGPMNIPL 1 IPI00000874.1
38 IPI00000875.5 Elongation factor 1-gamma Nucl(G1); Cyto(GO) - 9.10E-01 (AAAPAPEEEMDECEQALAAEPK;ALIAAQYSGAQVR;LDPGSEETQTLVR;STFVLDEFKR;VPAFEGDDGFCVFESNAIAYYVSNEELR;YSNEDTLSVALPYFWEHFDK;EYFSWEGAFQHVGK;GQELAFPLSPDWQVDYESYTWR;GSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNK - - - 1.16E+00 (ALIAAQYSGAQVR;LDPGSEETQTLVR;STFVLDEFKR;YSNEDTLSVALPYFWEHFDK;EYFSWEGAFQHVGK;GQELAFPLSPDWQVDYESYTWR;ILGLLDAYLK;KLDPGSEETQTLVR;VLSAPPHFHFGQTNR;WFLTCINQPQFR) 2 IPI00747497.1, IPI00000875.5
39 IPI00000877.1 150 kDa oxygen-regulated protein precursor ER(SP) 2.69E-01 (AANSLEAFIFETQDK;AEAGPEGVAPAPEGEK;AEAGPEGVAPAPEGEKK;LGNTISSLFGGGTTPDAK;LIPEMDQIFTEVEMTTLEK;LPATEKPVLLSK;SLAEDFAEQPIK;VESVFETLVEDSAEEESTLTK;VLQLINDNTATALSYGVFR;YSHDFNFHINYGDLGFLGPEDLR) 3.82E-02 (LPATEKPVLLSK;NINADEAAAMGAVYQAAALSK;YSHDFNFHINYGDLGFLGPEDLR;LIPEMDQIFTEVEMTTLEK;VESVFETLVEDSAEEESTLTK;LAGLFNEQR;LYQPEYQEVSTEEQREEISGK;QADNPHVALYQAR) - 3.07E+00 (AANSLEAFIFETQDK;AEAGPEGVAPAPEGEK;AHFNLDESGVLSLDR;DAVITVPVFFNQAER;DAVVYPILVEFTR;DEPGEQVELKEEAEAPVEDGSQPPPPEPK;EEAEAPVEDGSQPPPPEPK;EVEEEPGIHSLK;FFGDSAASMAIK;FPEHELTFDPQR;LAGLFNEQR;LGNTISSLFGGG 1.90E+00 (AANSLEAFIFETQDK;AEAGPEGVAPAPEGEK;AHFNLDESGVLSLDR;DAVITVPVFFNQAER;DAVVYPILVEFTR;DEPGEQVELKEEAEAPVEDGSQPPPPEPK;EEAEAPVEDGSQPPPPEPK;EVEEEPGIHSLK;LAGLFNEQR;LGNTISSLFGGGTTPDAK;LIPEMDQIFTEVEMTTLEK 8.40E-02 (VLQLINDNTATALSYGVFR;VESVFETLVEDSAEEESTLTK;YSHDFNFHINYGDLGFLGPEDLR;AANSLEAFIFETQDK;DAVVYPILVEFTR;LPATEKPVLLSK) 1 IPI00000877.1
40 IPI00000948.3 Transducin beta-like 2 protein ER(G2) - - - 4.57E-02 (LQQQLTQAQETLK;LALSPNAQVLALASGSSIHLYNTR;ANVELDHATLVR) 6.14E-02 (LQQQLTQAQETLK;ANVELDHATLVR;LALSPNAQVLALASGSSIHLYNTR) - 1 IPI00000948.3
41 IPI00000949.1 Mu-crystallin homolog Cyto(SP,GO,HPA); Nucl(GO,HPA); PM(GO,HPA) - 4.59E-01 (EAVLYVDSQEAALK;ESGDVLLSGAEIFAELGEVIK;FADTVQGEVR;GITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAK;GYLGVMPAYSAAEDALTTK;VPAFLSAAEVEEHLR) - - 1.26E-01 (ESGDVLLSGAEIFAELGEVIK;FADTVQGEVR;VPAFLSAAEVEEHLR) - 1 IPI00000949.1
42 IPI00000977.1 Mitogen-activated protein kinase kinase kinase 11 Nucl(G2); Cyto(SP) - - - 1.62E-02 (EHLLAQWELEVFER;SPPLGLISR) - - 1 IPI00000977.1
43 IPI00001022.5 myofibrillogenesis regulator 1 isoform 3 Mito(G2,SP,GO,HPA); Cyto(SP); Nucl(SP) - - 7.59E-02 (EEPEPLSPELEYIPR;ASSQSAPSPDVGSGVQT) - - - 1 IPI00001022.5
44 IPI00001091.3 AFG3-like protein 2 Mito(SP,GO,MitoP2,HPA) 5.52E-02 (SSGGGGGGGGKRGGK;TVAYHEAGHAVAGWYLEHADPLLK;GLGYAQYLPK;VGQISFDLPR;NLETLQQELGIEGENR) - 7.32E-02 (TPVDGQYVWFNIGSVDTFER;VALLLLEK;VGQISFDLPR;NLETLQQELGIEGENR;ASEEIFFGRITTGAQDDLRK;DFVNNYLSK) - 4.29E-02 (DVAGCEEAKLEIMEFVNFLKNPK;ASEEIFFGRITTGAQDDLRK) - 1 IPI00001091.3
45 IPI00001120.1 OTTHUMP00000021174 ER(G2) - 1.91E-02 (AFSGLLSLEQLTLEK;NNGAVVEGEVAGPRRFNMK) - - - - 1 IPI00001120.1
46 IPI00001159.9 GCN1-like protein 1 Cyto(G2,HPA) - 1.78E-02 (GEPGAAPLSAPAFSLVFPFLK;FSSVQLLGDLLFHISGVTGK;HLGVILPAVMLALK;VLAFLSSVAGDALTR;LLTWVIGTGSPR;ILPEIIPILEEGLR;ALGTLVSHVTLR;AIITALGVER;NRVLAGLYMGR) 4.30E-03 (SGAAQGLAEVMAGLGVEK;NPEILAIAPVLLDALTDPSR) 1.83E-02 (GEPGAAPLSAPAFSLVFPFLK;MTTETASEDDNFGTAQSNK;FVHFIDAPSLALIMPIVQR;ENVNSLLPVFEEFLK;ILPEIIPILEEGLR;VLAFLSSVAGDALTR;AASQSTQVPTITEGVAAALLLLK;HAVDGAVKKLTK) - 5.84E-03 (GEPGAAPLSAPAFSLVFPFLK;NPSGLTQYIPVLVDSFLPLLK) 1 IPI00001159.9
47 IPI00001192.6 KIAA1370 Nucl(G2) - - - - 1.85E-02 (DCLSTCEQPKNTEVLR;IINENYNPK) - 2 IPI00001192.6, IPI00797998.1
48 IPI00001364.2 Isoform A of GC-rich sequence DNA-binding factor homolog Nucl(G1); Cyto(GO) - - - - - 4.33E-02 (TGGAFSNALSSLNVLRPGEIPDAAFIHAAR;ERDEEQEPPPLLPPPGTGEEAGPGGGDR;TLQELSIDGLLNR) 1 IPI00001364.2
49 IPI00001434.1 Protocadherin beta 14 precursor PM(G2) - - - 2.11E-02 (DINDHSPTFLDK;SLDYEALQEFEFR) - - 1 IPI00001434.1
50 IPI00001441.3 Isoform A of Formimidoyltransferase-cyclodeaminase Cyto(G1,SP,GO) 7.33E-02 (EAQELSLPVVGSQLVGLVPLK;ENLFILEEEQR) 8.00E+00 (ALLDAAAFYCEK;ALLDAAAFYCEKENLFILEEEQR;ENLFILEEEQR;KLQQADWAPDFGPSSFVPSWGATATGAR;FLIAFNINLLGTK;LQQADWAPDFGPSSFVPSWGATATGAR;KVQGIGWYLDEK;NLAQVSTNLLDFEVTALHTVYEETCR;TVYTFVGPPECVVEGALNAAR;NQEVIDAI - 9.94E-02 (AVSVPLTLAETVASLWPALQELAR;EAQELSLPVVGSQLVGLVPLK;LTTLVDADAEAFTAYLEAMR;SAAPGGGSVAAAAAAMGAALGSMVGLMTYGR;ENLFILEEEQR;DITDEAFKDQIHHR) 3.32E-01 (AVSVPLTLAETVASLWPALQELAR;EAQELSLPVVGSQLVGLVPLK;ENLFILEEEQR;IIEYLVPER;LAEELDVPVYLYGEAAR;LTTLVDADAEAFTAYLEAMR;SAAPGGGSVAAAAAAMGAALGSMVGLMTYGR;VQGIGWYLDEK;DITDEAFKDQIHHR) 2.67E-01 (NLAQVSTNLLDFEVTALHTVYEETCR;EAQELSLPVVGSQLVGLVPLK;KFLIAFNINLLGTK;AVSVPLTLAETVASLWPALQELAR;TQAALVLDCLETR) 1 IPI00001441.3
51 IPI00001453.2 Alpha-internexin Cyto(G2) - 7.07E-03 (EYQDLLNVK;TIEIEGLRGANESLER) - - - - 1 IPI00001453.2
52 IPI00001458.1 Kinetochore-associated protein 1 Nucl(G2,SP); Cyto(SP,GO) - 8.68E-03 (LLRGYGIREVNLLNK;LIALTASANKK;PSELFELQEDEALR) - - - - 1 IPI00001458.1
53 IPI00001466.2 Echinoderm microtubule-associated protein-like 4 Cyto(G1) - 2.67E-01 (ADQFLVGTSR;AHDGSVFTLCQMR;DLLLTCAQDR;DVIINQEGEYIK;LVDEPGHCADFHPSGTVVAIGTHSGR;HKDVIINQEGEYIK;IILWDHDLNPER;LSLPQNETVADTTLTK;SHIFFWTWSGNSLTR;TTNEVVLAVEFHPTDANTIITCGK;YSAHSSHVTNVSFTHNDSHLISTGGK;G - - - - 1 IPI00001466.2
54 IPI00001498.1 Isoform 1 of Protocadherin alpha 2 precursor Nucl(G1); PM(GO) - 9.74E-03 (AGMHSSVHLEEAGILR;FTIDPISGEIRTK) - - - 3.50E-02 (VGLYTGEISTTRALDEADSPR;AGTAAGAVSELVPWSVGAGHVVAKVR) 1 IPI00001498.1
55 IPI00001515.1 Isoform 1 of Protocadherin alpha 1 precursor PM(G2,GO) - 9.38E-03 (AGMHSSVHLEEAGILR;LLNSRFPIEGAADADIGANALLTYTLSPSDYFSLDVEASDELSK) - - - - 2 IPI00218712.1, IPI00001515.1
56 IPI00001539.8 3-ketoacyl-CoA thiolase, mitochondrial Mito(SP,GO,MitoP2) 1.83E+00 (DFTATDLSEFAAK;DGTVTAGNASGVADGAGAVIIASEDAVK;DGTVTAGNASGVADGAGAVIIASEDAVKK;DMDLVEVNEAFAPQYLAVER;ITAHLVHELR;QTMQVDEHARPQTTLEQLQK;TNVNGGAIALGHPLGGSGSR;TPFGAYGGLLK) 1.56E+00 (DFTATDLSEFAAK;DGTVTAGNASGVADGAGAVIIASEDAVK;DGTVTAGNASGVADGAGAVIIASEDAVKK;DMDLVEVNEAFAPQYLAVER;ISREECDKYALQSQQR;LEDSLWVSLTDQHVQLPMAMTAENLAVK;QTMQVDEHARPQTTLEQLQK;RTPFGAYGGLLK;TNVNGGAIALGHPLGG 1.64E+01 (AANDAGYFNDEMAPIEVK;SLDLDISK;DFTATDLSEFAAK;DGTVTAGNASGVADGAGAVIIASEDAVK;DGTVTAGNASGVADGAGAVIIASEDAVKK;DMDLVEVNEAFAPQYLAVER;KDGTVTAGNASGVADGAGAVIIASEDAVK;KDGTVTAGNASGVADGAGAVIIASEDAVKK;QTMQVDE 4.12E-01 (AANDAGYFNDEMAPIEVK;DFTATDLSEFAAK;DGTVTAGNASGVADGAGAVIIASEDAVK;TNVNGGAIALGHPLGGSGSR;TPFGAYGGLLK;VSPETVDSVIMGNVLQSSSDAIYLAR;QTMQVDEHARPQTTLEQLQK) 3.54E-01 (AANDAGYFNDEMAPIEVK;DFTATDLSEFAAK;DGTVTAGNASGVADGAGAVIIASEDAVK;DMDLVEVNEAFAPQYLAVER;TNVNGGAIALGHPLGGSGSR;VSPETVDSVIMGNVLQSSSDAIYLAR;TPFGAYGGLLK;ITAHLVHELR) 5.64E+00 (DFTATDLSEFAAK;DGTVTAGNASGVADGAGAVIIASEDAVK;DGTVTAGNASGVADGAGAVIIASEDAVKK;DMDLVEVNEAFAPQYLAVER;ISREECDKYALQSQQR;KDGTVTAGNASGVADGAGAVIIASEDAVKK;QTMQVDEHARPQTTLEQLQK;RTPFGAYGGLLK;TNVNGGAIALGHPL 1 IPI00001539.8
57 IPI00001568.1 Vacuolar ATP synthase subunit D Cyto(G1,GO) - 1.25E-01 (RVNAIEHVIIPR;TLAYIITELDER;VNAIEHVIIPR;AAGEVLEPANLLAEEKDEDLLFE;AVELLVELASLQTSFVTLDEAIK;FTAGDFSTTVIQNVNK) - - - - 1 IPI00001568.1
58 IPI00001578.2 hypothetical protein LOC79415 ER(G1) - - - 1.74E-01 (AGHDQVVVLLHDVR;LATGFSHPLTQSAVMGHR;MYLQVETR) 1.86E-01 (AGHDQVVVLLHDVR;LATGFSHPLTQSAVMGHR) - 3 IPI00001578.2, IPI00792773.1, IPI00795592.1
59 IPI00001580.4 Isoform 1 of FYVE and coiled-coil domain-containing protein 1 Cyto(G2); Nucl(G2) - 1.93E-02 (AHVQELLQCSER;EEVEQCQQLAEAR;ESAIQGSLASLEAEQASIR;IFCYYCCNNYVLSK;ELAAQLALSQAQLEVHQGEVQR;AAVSQQGEQLQTER) - - - - 1 IPI00001580.4
60 IPI00001636.1 Ataxin-10 Cyto(SP,GO) - 3.62E-02 (DPSQVENLASSLQLITECFR;HAELIASTFVDQCK;NLTEDNSQNQDLIAK;HPESEWPFLIITDLFLK) - - - - 1 IPI00001636.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home