Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
571 IPI00010740.1 Isoform Long of Splicing factor, proline- and glutamine-rich Nucl(SP,GO) - - - - - 1.53E+01 (DKLESEMEDAYHEHQANLLR;MPGGPKPGGGPGLSTPGGHPKPPHR;PGGGPGLSTPGGHPKPPHR;YGEPGEVFINK;CSEGVFLLTTTPR;CSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEK;FAQHGTFEYEYSQR;FATHAAALSVR;LFVGNLPADITEDEFKR;LFVGNLPADITEDEFK;NL 1 IPI00010740.1
572 IPI00010779.4 Tropomyosin 4 Cyto(G1,SP,GO) 2.94E-02 (IQLVEEELDR;YSEKEDKYEEEIK) 7.90E-01 (IQLVEEELDR;RIQLVEEELDR;LVILEGELER;KLVILEGELER;CGDLEEELK;EENVGLHQTLDQTLNELNCI;YSEKEDKYEEEIK;IQALQQQADEAEDR;KIQALQQQADEAEDR) - 6.37E-02 (IQALQQQADEAEDR;KLVILEGELER;YSEKEDKYEEEIK) 8.87E-02 (IQLVEEELDR;RIQLVEEELDR;YSEKEDKYEEEIK;KIQALQQQADEAEDR;IQALQQQADEAEDR) 1.46E-01 (IQALQQQADEAEDR;YSEKEDKYEEEIK;KIQALQQQADEAEDR;IQLVEEELDR) 1 IPI00010779.4
573 IPI00010790.1 Biglycan precursor Nucl(G1) - - - - - 4.58E-02 (EISPDTTLLDLQNNDISELR;NHLVEIPPNLPSSLVELR) 3 IPI00010790.1, IPI00639967.1, IPI00643384.1
574 IPI00010796.1 Protein disulfide-isomerase precursor ER(G1,SP,GO,HPA); PM(GO) 9.87E+00 (EADDIVNWLK;ENLLDFIK;TGPAATTLPDGAAAESLVESSEVAVIGFFK;HNQLPLVIEFTEQTAPK;ILEFFGLK;ILFIFIDSDHTDNQR;KSNFAEALAAHK;LGETYKDHENIVIAK;LITLEEEMTK;MDSTANEVEAVK;NFEDVAFDEK;NFEDVAFDEKK;NNFEGEVTKENLLDFIK;QF 1.06E+00 (HNQLPLVIEFTEQTAPK;ILFIFIDSDHTDNQR;LGETYKDHENIVIAK;NFEDVAFDEKK;QFLQAAEAIDDIPFGITSNSDVFSK;SNFAEALAAHK;THILLFLPK;VDATEESDLAQQYGVR;YKPESEELTAER;YQLDKDGVVLFK;TGPAATTLPDGAAAESLVESSEVAVIGFFK;ILEFFG 4.32E-01 (HNQLPLVIEFTEQTAPK;LGETYKDHENIVIAK;NFEDVAFDEKK;QFLQAAEAIDDIPFGITSNSDVFSK;VDATEESDLAQQYGVR;YQLDKDGVVLFK;TGPAATTLPDGAAAESLVESSEVAVIGFFK;ILFIFIDSDHTDNQR;SNFAEALAAHK;THILLFLPK;YKPESEELTAER) 3.56E+01 (EADDIVNWLK;ENLLDFIK;ILFIFIDSDHTDNQR;FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK;FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL;HNQLPLVIEFTEQTAPK;IFGGEIKTHILLFLPK;IKPHLMSQELPEDWDK;IKPHLMSQELPEDWDKQPVK;ILEFF 2.74E+01 (DGVVLFK;EADDIVNWLK;ENLLDFIK;FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK;FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL;IKPHLMSQELPEDWDKQPVK;HNQLPLVIEFTEQTAPK;IFGGEIKTHILLFLPK;IKPHLMSQELPEDWDK;ILEFFGLK;ILFI 3.55E+00 (HNQLPLVIEFTEQTAPK;ILFIFIDSDHTDNQR;LGETYKDHENIVIAK;NFEDVAFDEKK;QFLQAAEAIDDIPFGITSNSDVFSK;RTGPAATTLPDGAAAESLVESSEVAVIGFFK;SNFAEALAAHK;THILLFLPK;VDATEESDLAQQYGVR;YKPESEELTAER;YQLDKDGVVLFK;EADDI 1 IPI00010796.1
575 IPI00010810.1 Electron transfer flavoprotein subunit alpha, mitochondrial precursor Mito(SP,GO,MitoP2,HPA) 2.99E+00 (ASSTSPVEISEWLDQK;DPEAPIFQVADYGIVADLFK;GTSFDAAATSGGSASSEK;LEVAPISDIIAIK;LLYDLADQLHAAVGASR;TIVAINKDPEAPIFQVADYGIVADLFK;TIYAGNALCTVK;GLLPEELTPLILATQK;LGGEVSCLVAGTK) 2.56E+00 (ASSTSPVEISEWLDQK;DPEAPIFQVADYGIVADLFK;IVAPELYIAVGISGAIQHLAGMK;LEVAPISDIIAIK;LLYDLADQLHAAVGASR;TIVAINKDPEAPIFQVADYGIVADLFK;GTSFDAAATSGGSASSEK;TIYAGNALCTVK;GLLPEELTPLILATQK;QFNYTHICAGASAFGK;LG 2.41E+01 (ASSTSPVEISEWLDQK;DPEAPIFQVADYGIVADLFK;IVAPELYIAVGISGAIQHLAGMK;LEVAPISDIIAIK;LLYDLADQLHAAVGASR;TIVAINKDPEAPIFQVADYGIVADLFK;GTSFDAAATSGGSASSEK;VKVFSVRGTSFDAAATSGGSASSEK;TIYAGNALCTVK;GLLPEELTPL 3.18E-01 (DPEAPIFQVADYGIVADLFK;LEVAPISDIIAIK;LLYDLADQLHAAVGASR;TIVAINKDPEAPIFQVADYGIVADLFK;GTSFDAAATSGGSASSEK;VFSVRGTSFDAAATSGGSASSEK;GLLPEELTPLILATQK) 1.33E-01 (DPEAPIFQVADYGIVADLFK;LEVAPISDIIAIK;LLYDLADQLHAAVGASR;GLLPEELTPLILATQK) 3.80E+00 (ASSTSPVEISEWLDQK;DPEAPIFQVADYGIVADLFK;LEVAPISDIIAIK;LLYDLADQLHAAVGASR;TIVAINKDPEAPIFQVADYGIVADLFK;GTSFDAAATSGGSASSEK;TIYAGNALCTVK;GLLPEELTPLILATQK;QFNYTHICAGASAFGK;LGGEVSCLVAGTK) 1 IPI00010810.1
576 IPI00010845.3 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial precursor PM(G1); Mito(GO,MitoP2,HPA) 1.28E+00 (EPATINYPFEK;TLLWTELFR) - 7.01E-02 (LCEAICPAQAITIEAEPR;EPATINYPFEK) - 1.07E-01 (GLGMTLSYLFR;EPATINYPFEK) - 1 IPI00010845.3
577 IPI00010860.1 Isoform p27-L of 26S proteasome non-ATPase regulatory subunit 9 Cyto(G2) - 8.88E-02 (ANYDVLESQK;QVEEALHQLHAR) - - - - 2 IPI00010860.1, IPI00216220.1
578 IPI00010896.2 Chloride intracellular channel protein 1 Cyto(SP,GO); Nucl(SP,GO) - 1.19E+00 (FLDGNELTLADCNLLPK;GVTFNVTTVDTK;GVTFNVTTVDTKR;LAALNPESNTAGLDIFAK;LCPGGQLPFLLYGTEVHTDTNK;LHIVQVVCK;NSNPALNDNLEK;VLDNYLTSPLPEEVDETSAEDEGVSQR;EEFASTCPDDEEIELAYEQVAK;GFTIPEAFR;KFLDGNELTLADCNLLPK) - - 2.04E-01 (GVTFNVTTVDTK;LAALNPESNTAGLDIFAK;NSNPALNDNLEK) - 2 IPI00647593.2, IPI00010896.2
579 IPI00010905.2 CLN3 protein (Fragment) Mito(G1) - - 1.01E-01 (QPLIRTEAPESKPGSSSSLSLR;GLLGLCNNFSYVVMLSAAHDILSHK) - - - 1 IPI00010905.2
580 IPI00010949.3 Isoform 1 of Sialate O-acetylesterase precursor Nucl(G1) - - 9.66E-02 (ELSNTAAYQSVR;FFPFGLVQLSSDLSK) - - 1.31E-01 (ELSNTAAYQSVR;FFPFGLVQLSSDLSK;WHQTADFGYVPNPK) 2 IPI00010949.3, IPI00759728.1
581 IPI00010951.1 Epiplakin Cyto(G2) 1.08E-02 (GFFDPNTHENLTYLQLLER;LLEAQIATGGIIDPVHSHR;LLEAQIATGGVIDPVHSHR;VPVDVAYR;AGTLTVEELGATLTSLLAQAQAQAR;RDELLAQHAAGALGLPDLVAVLTR;EELLAEFGSGTLDLPALTR;PGTALILLEAQAATGFIIDPKANKGHSVEEALR) 7.57E-03 (GFFDPNTHENLTYLQLLER;GYFDEEMNR;LLEAQIATGGIIDPVHSHR;VPVDVAYR;GFFDPNTHENLTYVQLLR;AGTLTVEELGATLTSLLAQAQAQAR;EELLAEFGSGTLDLPALTR;EGQGEGETQEAAAAAAAAR;EGQGEGETQEAAAATAAAR;RDELLAQHAAGALGLPDLVAVLTR;Y - - - 1.61E-03 (LLEAQIATGGIIDPVHSHR;LLEAQIATGGVIDPVHSHR;GFFDPNTHENLTYLQLLER;QADIMLPALRSR) 1 IPI00010951.1
582 IPI00011044.1 Oxygen-regulated protein 1 Nucl(G2) 1.05E-02 (ASAILSKQHATTR;EPFKPGNYDIQK) - - - - - 1 IPI00011044.1
583 IPI00011062.1 Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor Mito(SP,GO,MitoP2) 2.61E+01 (AADTIGYPVMIR;AEQPDGLILGMGGQTALNCGVELFK;AFAISGPFNVQFLVK;AFAMTNQILVEK;AIDDNMSLDEIEK;ATGYPLAFIAAK;AVNTLNEALEFAK;CLGLTEAQTR;DGSIDLVINLPNNNTK;EIEYEVVR;EWPSNLDLR;FLGVAEQLHNEGFK;FVHDNYVIR;GILIGIQQS 1.09E+01 (AADTIGYPVMIR;AEQPDGLILGMGGQTALNCGVELFK;AFAISGPFNVQFLVK;AFAMTNQILVEK;AIDDNMSLDEIEK;ATGYPLAFIAAK;ATGYPLAFIAAKIALGIPLPEIK;AVNTLNEALEFAK;CLGLTEAQTR;ILDIYHQEACGGCIISVGGQIPNNLAVPLYK;EWPSNLDLR;FVHD 9.95E+01 (VLILGSGGLSIGQAGEFDYSGSQAVK;AADTIGYPVMIR;AEQPDGLILGMGGQTALNCGVELFK;AFAISGPFNVQFLVK;AFAMTNQILVEK;AIDDNMSLDEIEK;KTVVVNCNPETVSTDFDECDKLYFEELSLER;KEPLFGISTGNLITGLAAGAK;AQTAHIVLEDGTK;ATGYPLAFIAAK; 5.91E+00 (AADTIGYPVMIR;AFAISGPFNVQFLVK;AFAMTNQILVEK;AIDDNMSLDEIEK;APMFSWPR;ATGYPLAFIAAK;AVNTLNEALEFAK;DGSIDLVINLPNNNTK;EIEYEVVR;ETLMDLSTK;FLGVAEQLHNEGFK;FVHDNYVIR;GILIGIQQSFR;GILIGIQQSFRPR;GLNSESMTEET 4.02E+00 (AADTIGYPVMIR;AFAISGPFNVQFLVK;AFAMTNQILVEK;AIDDNMSLDEIEK;AVNTLNEALEFAK;DGSIDLVINLPNNNTK;EIEYEVVR;ETLMDLSTK;FLGVAEQLHNEGFK;FVHDNYVIR;GLNSESMTEETLK;GLNSESMTEETLKR;HLPTLDHPIIPADYVAIK;IALGIPLPEIK 1.05E+01 (AADTIGYPVMIR;AEQPDGLILGMGGQTALNCGVELFK;AFAISGPFNVQFLVK;AFAMTNQILVEK;ATGYPLAFIAAK;AVNTLNEALEFAK;CLGLTEAQTR;EIEYEVVR;FLGVAEQLHNEGFK;FVHDNYVIR;GILIGIQQSFRPR;GLNSESMTEETLKR;GNDVLVIECNLR;HLPTLDHP 1 IPI00011062.1
584 IPI00011075.1 Alanine--glyoxylate aminotransferase 2, mitochondrial precursor Mito(G1,GO,MitoP2) - 6.25E-02 (SIAGFFAEPIQGVNGVVQYPK;GGVCIADEVQTGFGR;LAALLPEPLK;EHLSPVVTAYFQK) 1.18E-01 (GGVCIADEVQTGFGR;DQYIEQFKDTLSTSVAK;SIAGFFAEPIQGVNGVVQYPK;AHSNNIDIISFR) - - - 1 IPI00011075.1
585 IPI00011107.2 Isocitrate dehydrogenase [NADP], mitochondrial precursor Mito(SP,GO,MitoP2,HPA) 3.96E-01 (FKDIFQEIFDK;GRPTSTNPIASIFAWTR;LIDDMVAQVLK;LNEHFLNTTDFLDTIK;TIEAEAAHGTVTR;YFDLGLPNR;NILGGTVFR) 4.90E-01 (DIFQEIFDK;DLAGCIHGLSNVK;GRPTSTNPIASIFAWTR;LNEHFLNTTDFLDTIK;NYDGDVQSDILAQGFGSLGLMTSVLVCPDGK;VCVETVESGAMTK;YFDLGLPNR;DQTDDQVTIDSALATQK;FKDIFQEIFDK;LILPHVDIQLK;NILGGTVFR;NILGGTVFREPIICK) 3.76E+00 (DIFQEIFDK;DLAGCIHGLSNVK;GRPTSTNPIASIFAWTR;LNEHFLNTTDFLDTIK;SSGGFVWACK;VCVETVESGAMTK;YFDLGLPNR;DQTDDQVTIDSALATQK;FKDIFQEIFDK;LIDDMVAQVLK;PTSTNPIASIFAWTR;GKLDGNQDLIR;LVPGWTKPITIGR;NIPRLVPGWTK; 1.62E-01 (DQTDDQVTIDSALATQK;FKDIFQEIFDK;LIDDMVAQVLK;LNEHFLNTTDFLDTIK;YFDLGLPNR;NILGGTVFR) 2.77E-02 (NILGGTVFR;LNEHFLNTTDFLDTIK) 3.58E-01 (DLAGCIHGLSNVK;GRPTSTNPIASIFAWTR;LNEHFLNTTDFLDTIK;FKDIFQEIFDK;NILGGTVFR) 1 IPI00011107.2
586 IPI00011126.6 26S protease regulatory subunit 4 Cyto(SP,GO,HPA); Nucl(SP,GO,HPA) - 3.26E-01 (APQETYADIGGLDNQIQEIK;AVANQTSATFLR;GVILYGPPGTGK;LPLVTPHTQCR;IKDYLLMEEEFIR;KIEFPLPDEK;TMLELLNQLDGFDSR;VAEEHAPSIVFIDEIDAIGTK;VVGSELIQK;KQEGTPEGLYL;TLLAKAVANQTSATFLR) - - 2.94E-02 (VAEEHAPSIVFIDEIDAIGTK;MTLADDVTLDDLIMAK) 1.22E-01 (APQETYADIGGLDNQIQEIK;AVANQTSATFLR;TMLELLNQLDGFDSR) 1 IPI00011126.6
587 IPI00011155.5 Isoform 1 of Asialoglycoprotein receptor 2 ER(G1); Nucl(GO); PM(GO) - - - 1.25E-01 (ADHDALLFHLK;DFQDIQQLSSEENDHPFHQGEGPGTR) 2.71E-01 (ADHDALLFHLK;DFQDIQQLSSEENDHPFHQGEGPGTR;FIVQHTNPFNTWIGLTDSDGSWK) - 3 IPI00011155.5, IPI00796731.1, IPI00797460.1
588 IPI00011174.1 Anosmin-1 precursor Cyto(G1); PM(SP) - 1.34E-02 (WSSKFNISIEPVIYVVQR;FNISIEPVIYVVQRR) - - - 2.40E-02 (KTTDGFQNSVILEK;FTELQSGQLEVK) 1 IPI00011174.1
589 IPI00011184.1 Sodium/hydrogen exchanger 3 PM(G2,GO) - - - - 2.58E-02 (MWGLGARGPDRGLLLALALGGLAR;ILNVFHELNLKDAISYVAEGER) - 1 IPI00011184.1
590 IPI00011197.4 sorting nexin 25 Cyto(G2) - - 1.19E-02 (HGIIKIFNALQETRANK;SIDQKFMEK) - - - 3 IPI00011197.4, IPI00024706.1, IPI00167024.4
591 IPI00011200.4 D-3-phosphoglycerate dehydrogenase Cyto(G1,HPA); Nucl(HPA); PM(HPA) - 4.11E+00 (EELIAELQDCEGLIVR;GTIQVITQGTSLK;ILQDGGLQVVEK;NAGNCLSPAVIVGLLK;QHVTEAFQFHF;SLTGVVNAQALTSAFSPHTK;SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR;TLGILGLGR;VLISDSLDPCCR;VTADVINAAEK;AGTGVDNVDLEAATR;ALQSGQCAGA - - 1.18E-01 (AGTGVDNVDLEAATR;TQTSDPAMLPTMIGLLAEAGVR;VTADVINAAEK;GGIVDEGALLR;ILQDGGLQVVEK) - 1 IPI00011200.4
592 IPI00011201.1 NAD-dependent malic enzyme, mitochondrial precursor Mito(SP,GO,MitoP2,HPA) - 1.72E-02 (NTLIQFEDFGNHNAFR;ILGLGDLGVYGMGIPVGK) 9.11E-02 (ALTSQLTDEELAQGR;HISDSVFLEAAK) - - - 1 IPI00011201.1
593 IPI00011229.1 Cathepsin D precursor Mito(G1) 5.44E+00 (AYWQVHLDQVEVASGLTLCK;ISVNNVLPVFDNLMQQK;KAYWQVHLDQVEVASGLTLCK;LLDIACWIHHK;LVDQNIFSFYLSR;VSTLPAITLK;YYTVFDR;LSPEDYTLK;QPGITFIAAK;YYTVFDRDNNR;FDGILGMAYPR) 1.32E+00 (AIGAVPLIQGEYMIPCEK;AYWQVHLDQVEVASGLTLCK;EGCEAIVDTGTSLMVGPVDEVR;FDGILGMAYPR;LVDQNIFSFYLSR;VSTLPAITLK;DPDAQPGGELMLGGTDSK;ISVNNVLPVFDNLMQQK;KAYWQVHLDQVEVASGLTLCK;YYTVFDRDNNR;LSPEDYTLK;YYTVFDR;Q 1.94E+00 (AYWQVHLDQVEVASGLTLCK;LSPEDYTLK;LVDQNIFSFYLSR;VSTLPAITLK;ISVNNVLPVFDNLMQQK;KAYWQVHLDQVEVASGLTLCK;QPGITFIAAK;YYTVFDR) 1.06E+00 (DPDAQPGGELMLGGTDSK;FDGILGMAYPR;ISVNNVLPVFDNLMQQK;LVDQNIFSFYLSR;VSTLPAITLK;YSQAVPAVTEGPIPEVLK) 1.40E+00 (DPDAQPGGELMLGGTDSK;FDGILGMAYPR;ISVNNVLPVFDNLMQQK;LVDQNIFSFYLSR;YSQAVPAVTEGPIPEVLK;VSTLPAITLK;LSPEDYTLK) 1.05E+00 (LLDIACWIHHK;YSQAVPAVTEGPIPEVLK;QPGITFIAAK;LVDQNIFSFYLSR;YYTVFDRDNNR;LSPEDYTLK;VSTLPAITLK;YYTVFDR) 1 IPI00011229.1
594 IPI00011250.3 Ubiquitin carboxyl-terminal hydrolase isozyme L3 Cyto(SP,HPA); Mito(HPA); Nucl(HPA) - 1.92E+00 (VDLHFIALVHVDGHLYELDGR;KPFPINHGETSDETLLEDAIEVCK;KPFPINHGETSDETLLEDAIEVCKK;PVCAVLLLFPITEK;YLENYDAIR;QTISNACGTIGLIHAIANNK;VTHETSAHEGQTEAPSIDEK;WLPLEANPEVTNQFLK) - - - - 1 IPI00011250.3
595 IPI00011252.1 Complement component C8 alpha chain precursor PM(G2,SP) - - - 9.60E-02 (AMAVEDIISR;KDDIMLDEGMLQSLMELPDQYNYGMYAK;YHFEALADTGISSEFYDNANDLLSK;YNPVVIDFEMQPIHEVLR;KAMAVEDIISR;MESLGITSR) 2.58E-02 (YNPVVIDFEMQPIHEVLR;AMAVEDIISR) - 2 IPI00011252.1, IPI00414018.2
596 IPI00011253.3 40S ribosomal protein S3 Cyto(SP,GO); Nucl(GO) - 1.91E+00 (AELNEFLTR;AELNEFLTRELAEDGYSGVEVRVTPTR;DEILPTTPISEQK;FVADGIFK;FVDGLMIHSGDPVNYYVDTAVR;KPLPDHVSIVEPK;KPLPDHVSIVEPKDEILPTTPISEQK;LLGGLAVR;RFGFPEGSVELYAEK;ELAEDGYSGVEVR;FGFPEGSVELYAEK;GLCAIAQAESL - 2.19E+00 (AELNEFLTR;DEILPTTPISEQK;ELAEDGYSGVEVR;FGFPEGSVELYAEK;FVDGLMIHSGDPVNYYVDTAVR;GGKPEPPAMPQPVPTA;KPLPDHVSIVEPK;KPLPDHVSIVEPKDEILPTTPISEQK;TEIIILATR;RFGFPEGSVELYAEK) 9.57E-01 (AELNEFLTR;DEILPTTPISEQK;ELAEDGYSGVEVR;FGFPEGSVELYAEK;GGKPEPPAMPQPVPTA;KPLPDHVSIVEPK;TEIIILATR;FVADGIFK) - 1 IPI00011253.3
597 IPI00011261.2 Complement component C8 gamma chain precursor Cyto(G1) - 3.32E-01 (YGFCEAADQFHVLDEVR;SLPVSDSVLSGFEQR;VQEAHLTEDQIFYFPK) - 1.68E-01 (SLPVSDSVLSGFEQR;VQEAHLTEDQIFYFPK) 2.16E-01 (SLPVSDSVLSGFEQR;VQEAHLTEDQIFYFPK;RPASPISTIQPK) 1.28E-01 (SLPVSDSVLSGFEQR;VQEAHLTEDQIFYFPK) 1 IPI00011261.2
598 IPI00011264.1 Complement factor H-related protein 1 precursor Nucl(G1) - - - - - 7.90E-01 (YKPFSQVPTGEVFYYSCEYNFVSPSK;ITCTEEGWSPTPK;LCFFPFVENGHSESSGQTHLEGDTVQIICNTGYR;LQNNENNISCVER;STDTSCVNPPTVQNAYIVSR) 1 IPI00011264.1
599 IPI00011268.2 RNA binding protein (Fragment) Nucl(G1,GO) - - - - - 1.83E-01 (GDGGGASGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEAR;SNIDALLSR;VFIGNLNTAIVK;GYAFVQYSNER;AASAIYSGYIFDYDYYR) 1 IPI00011268.2
600 IPI00011274.2 heterogeneous nuclear ribonucleoprotein D-like Cyto(G1,SP); Nucl(G1,SP,GO) - 5.25E-02 (GFGFVLFK;VFVGGLSPDTSEEQIK;GFCFITYTDEEPVKK;MFIGGLSWDTSKK) - - - 5.16E-01 (DLTEYLSR;FGEVVDCTLK;VFVGGLSPDTSEEQIK;GFCFITYTDEEPVK;GFCFITYTDEEPVKK;GFGFVLFK;RGFCFITYTDEEPVKK) 2 IPI00045498.3, IPI00011274.2
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home