Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
601 IPI00011276.1 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor Mito(SP,GO,MitoP2) - - 1.48E+00 (DPTAVIFGEDVAFGGVFR;MNLFQSVTSALDNSLAK;SGDLFNCGSLTIR;SPWGCVGHGALYHSQSPEAFFAHCPGIK;GLLLSCIEDKNPCIFFEPK;NPCIFFEPK;AAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIR;LLISHEAPLTGGFASEISSTVQEECFLNLEAPISR;VCG - - 1.80E-01 (DPTAVIFGEDVAFGGVFR;LLISHEAPLTGGFASEISSTVQEECFLNLEAPISR;LGVSCEVIDLR) 1 IPI00011276.1
602 IPI00011283.2 Isoform 1 of Collagen alpha-2(XI) chain precursor ER(G2) 1.35E-02 (GDRGFDGLPGLPGEK;AKGICPADVAYR) 3.45E-03 (LGVPGLPGYPGRQGPK;FPSLPDGVRR) - - - - 16 IPI00011283.2, IPI00219922.2, IPI00219923.2, IPI00219924.2, IPI00219925.2, IPI00219927.2, IPI00413940.2, IPI00644208.1, IPI00742668.1, IPI00743588.1, IPI00744051.1, IPI00748160.1, IPI00748510.1, IPI00
603 IPI00011284.1 Isoform Membrane-bound of Catechol O-methyltransferase Cyto(G1,SP,GO); PM(SP,GO) 1.34E-01 (LITIEINPDCAAITQR;VTLVVGASQDIIPQLK;YLPDTLLLEECGLLR) 4.97E+00 (AIYKGPGSEAGP;DKVTLVVGASQDIIPQLK;GTVLLADNVICPGAPDFLAHVR;IVDAVIQEHQPSVLLELGAYCGYSAVR;KYDVDTLDMVFLDHWK;VTLVVGASQDIIPQLK;VTLVVGASQDIIPQLKK;GSSCFECTHYQSFLEYR;ILNHVLQHAEPGNAQSVLEAIDTYCEQK;KGTVLLAD - 2.43E-01 (KYDVDTLDMVFLDHWK;DKVTLVVGASQDIIPQLK;VTLVVGASQDIIPQLK) 2.32E-01 (DKVTLVVGASQDIIPQLK;VTLVVGASQDIIPQLK;YDVDTLDMVFLDHWK) 9.97E-01 (GTVLLADNVICPGAPDFLAHVR;VTLVVGASQDIIPQLK;ILNHVLQHAEPGNAQSVLEAIDTYCEQK;KGTVLLADNVICPGAPDFLAHVR;LITIEINPDCAAITQR;YLPDTLLLEECGLLR;IVDAVIQEHQPSVLLELGAYCGYSAVR) 2 IPI00011284.1, IPI00375513.3
604 IPI00011285.1 Calpain-1 catalytic subunit Cyto(G1,GO,HPA) - 7.90E-01 (APSDLYQIILK;IRLDETDDPDDYGDR;KLYELIITR;LGLVEFNILWNR;LVFVHSAEGNEFWSALLEK;LYELIITR;RPTELLSNPQFIVDGATR;TLDTDLDGVVTFDLFK;WKRPTELLSNPQFIVDGATR;YLGQDYEQLR;ESGCSFVLALMQK;FRLPPGEYVVVPSTFEPNKEGDFVLR;G - - - - 1 IPI00011285.1
605 IPI00011302.1 CD59 glycoprotein precursor Cyto(G1); PM(SP) - 2.29E-01 (FEHCNFNDVTTR;LRENELTYYCCK) - - - 4.95E-01 (FEHCNFNDVTTR;LRENELTYYCCK) 1 IPI00011302.1
606 IPI00011400.1 T-lymphoma invasion and metastasis-inducing protein 1 Nucl(G2); Cyto(GO) - - - - 5.65E-02 (FTIDSDAVSASSPEK;TAVVLVYKDGSKQK;SDTAADTYGFSLSSVEEDGIR) - 1 IPI00011400.1
607 IPI00011416.2 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursor Mito(G1,GO,MitoP2,HPA) 3.83E+00 (EVDVGLAADVGTLQR;VNLLYSR;YCAQDAFFQVK;VFPDKEVMLDAALALAAEISSK;HVLHVQLNRPNK;VIGNQSLVNELAFTAR;YQETFNVIER) 1.09E+00 (EVDVGLAADVGTLQR;VFPDKEVMLDAALALAAEISSK;YCAQDAFFQVK;VNLLYSR;VIGNQSLVNELAFTAR;CPKPVIAAVHGGCIGGGVDLVTACDIR;YQETFNVIER;LTGSSAQEEASGVALGEAPDHSYESLR) 1.47E+01 (EVDVGLAADVGTLQR;VFPDKEVMLDAALALAAEISSK;VNLLYSR;YCAQDAFFQVK;MFTAGIDLMDMASDILQPK;PVIAAVHGGCIGGGVDLVTACDIR;VIGNQSLVNELAFTAR;CPKPVIAAVHGGCIGGGVDLVTACDIR;LTGSSAQEEASGVALGEAPDHSYESLR;YQETFNVIER;IS 1.06E+00 (EVDVGLAADVGTLQR;MMADEALGSGLVSR;VFPDKEVMLDAALALAAEISSK;EVDVGLAADVGTLQRLPK;SVQATTENKELKTVTFSK;VNLLYSR;MFTAGIDLMDMASDILQPK;VIGNQSLVNELAFTAR;YQETFNVIER) 3.73E-01 (MFTAGIDLMDMASDILQPK;MMADEALGSGLVSR;VFPDKEVMLDAALALAAEISSK;VIGNQSLVNELAFTAR;YQETFNVIER) 5.02E+00 (EVDVGLAADVGTLQR;YCAQDAFFQVK;VNLLYSR;PVIAAVHGGCIGGGVDLVTACDIR;VIGNQSLVNELAFTAR;CPKPVIAAVHGGCIGGGVDLVTACDIR;YQETFNVIER;LTGSSAQEEASGVALGEAPDHSYESLR) 1 IPI00011416.2
608 IPI00011454.1 Isoform 2 of Neutral alpha-glucosidase AB precursor ER(G2,GO) - - - 8.96E-02 (AEKDEPGAWEETFK;ALLDSLQLGPDSLTVHLIHEVTK;DENSVELTMAEGPYK;DVHNIYGLYVHMATADGLR;HHGPQTLYLPVTLSSIPVFQR;QYASLTGTQALPPLFSLGYHQSR;EPWLLPSQHNDIIR;FGAVWTGDNTAEWDHLK;FRIDELEPR;FSFSGNTLVSSSADPEGHFETPIWIE 8.76E-02 (AEKDEPGAWEETFK;ALLDSLQLGPDSLTVHLIHEVTK;DDPITLFVALSPQGTAQGELFLDDGHTFNYQTR;DENSVELTMAEGPYK;DVHNIYGLYVHMATADGLR;EPWLLPSQHNDIIR;FGAVWTGDNTAEWDHLK;FRIDELEPR;FSFSGNTLVSSSADPEGHFETPIWIER;HHGPQTLYLP - 1 IPI00011454.1
609 IPI00011511.1 Isoform 2 of Cat eye syndrome critical region protein 5 precursor Mito(G1) 6.08E-02 (VPVVFVTNAGNILQHSK;PSILTYQYAEDLIR) - 3.61E-01 (PSILTYQYAEDLIR;FGHGTFLLCLETIYQK;NPQSTEPVLGGGEPPFHGHR;VPVVFVTNAGNILQHSK;IEGVLLLGEPVR) - - - 2 IPI00011511.1, IPI00299177.4
610 IPI00011528.1 Cleavage stimulation factor 50 kDa subunit Nucl(SP,GO) - - - - 4.01E-02 (CIVHSPTNPGFMTCSDDFR;DGQLIATGSADASIK) 2.62E-01 (AHDGAEVCSAIFSK;SISFHPSGDFILVGTQHPTLR;TLYDHVDEVTCLAFHPTEQILASGSR;TQAVFNHTEDYVLLPDER) 1 IPI00011528.1
611 IPI00011550.1 Zinc finger CCHC domain-containing protein 3 Nucl(G2) - - - - 2.64E-02 (AEAAAAAMATPAR;EKMGWAQVVKNLAEK) - 1 IPI00011550.1
612 IPI00011569.2 Acetyl-CoA carboxylase 1 Cyto(SP,GO) - 9.50E-02 (RIPVQAVWAGWGHASENPK;VLIANNGIAAVK;DFTVASPAEFVTR;FVVMVTPEDLK;EGSLSPASVGSDTLSDLGISSLQDGLALHIR;EASFEYLQNEGER;EREEFLIPIYHQVAVQFADLHDTPGR;FGAYIVDGLR;IHNANPELTDGQIQAMLR;TLRDPSLPLLELQDIMTSVSGR;VEVGT - 8.14E-03 (IHNANPELTDGQIQAMLR;QGPLHGMLINTPYVTK;YLYLTPQDYKR) - - 2 IPI00396015.4, IPI00011569.2
613 IPI00011592.3 Cytoplasmic dynein 1 light intermediate chain 2 Nucl(G1); Cyto(GO) - - - - 2.64E-02 (NNAASEGVLASFFNSLLSK;TQGRGGPASVPSSSPGTSVK) 1.10E-01 (IAILHENFTTVKPEDAYEDFIVKPPVR;NNAASEGVLASFFNSLLSK;TYGFHFTTPALVVEK;FCLQYGAALIYTSVK) 1 IPI00011592.3
614 IPI00011603.2 26S proteasome non-ATPase regulatory subunit 3 Cyto(G1) - 2.02E-01 (AIQLEYSEAR;AVQGFFTSNNATR;LQLDSPEDAEFIVAK;ELDTVTLEDIKEHVK;HDADGQATLLNLLLR;NYLHYSLYDQAEK;VYEFLDKLDVVR;ELDTVTLEDIK;SLMPYFLLTQAVR;DGVIEASINHEK;FQADGTYTLIIR) - 2.67E-02 (AIQLEYSEAR;NYLHYSLYDQAEK;FNQVLDQFGEK) - - 1 IPI00011603.2
615 IPI00011609.3 Isoform II of Ubiquitin-protein ligase E3A Nucl(G1) - - - - - 4.69E-02 (LEMIAMENPADLKK;MYSERRITVLYSLVQGQQLNPYLR) 4 IPI00011609.3, IPI00107754.2, IPI00219197.1, IPI00219198.1
616 IPI00011631.5 Centromere/kinetochore protein zw10 homolog Cyto(G2,SP,GO); ER(SP,GO); Nucl(SP,GO) - - - 5.15E-02 (AMGTLLNTAISEVIGK;INVPELPTPDEDNKLEVQK;LQQYEEIIQSTEEFENALK;NIFHLFHDVVPTYHK) 3.16E-02 (AMGTLLNTAISEVIGK;DLHVSTGEFTDLK;LQQYEEIIQSTEEFENALK;WMPFKELMMMLQASLQEIGDR) - 1 IPI00011631.5
617 IPI00011635.3 Isoform 2 of Bcl-2-like 13 protein Cyto(G1); Mito(MitoP2) 2.51E-01 (EESLVEELSPASEK;AATTEPTEVEEVVPALEPTETLLSEK;YVVLSYLGLLSQEK;ELQEALPEAPAPLLPHITATSLLGTR) 7.64E-02 (SLDKEISEAFTSTGFDR;YVVLSYLGLLSQEK) - - 4.64E-02 (EESLVEELSPASEK;LQEQHLSSPQGVQLDIASQSLDQEILLK) - 1 IPI00011635.3
618 IPI00011642.4 Isoform 1 of Receptor-type tyrosine-protein phosphatase delta precursor PM(G2,GO) - - 6.77E-03 (GFPTIDMGPQLKVVER;GYQVHYVRMENGEPK) - 1.16E-02 (SYSFVLTNRGNSAGGLQHRVTAK;NKVGFGEEMVK) 9.20E-03 (SYSFVLTNRGNSAGGLQHR;VTAKTAPDVLR) 4 IPI00011642.4, IPI00375547.2, IPI00375548.2, IPI00796452.1
619 IPI00011654.2 Tubulin beta chain PM(G1); Cyto(SP,GO) 9.42E+00 (AILVDLEPGTMDSVR;EIVHIQAGQCGNQIGAK;FPGQLNADLR;GHYTEGAELVDSVLDVVR;ISEQFTAMFR;SGPFGQIFRPDNFVFGQSGAGNNWAK;LAVNMVPFPR;LHFFMPGFAPLTSR;NSSYFVEWIPNNVK;ALTVPELTQQVFDAK;IMNTFSVVPSPK;LTTPTYGDLNHLVSATMS 5.34E+00 (EAESCDCLQGFQLTHSLGGGTGSGMGTLLISK;LAVNMVPFPR;FPGQLNADLR;KLAVNMVPFPR;LHFFMPGFAPLTSR;FPGQLNADLRK;EVDEQMLNVQNK;GHYTEGAELVDSVLDVVR;NSSYFVEWIPNNVK;TAVCDIPPR;AILVDLEPGTMDSVR;EIVHIQAGQCGNQIGAK;ISEQF - 5.06E+00 (AILVDLEPGTMDSVR;EVDEQMLNVQNK;FPGQLNADLR;GHYTEGAELVDSVLDVVR;ISEQFTAMFR;LAVNMVPFPR;LHFFMPGFAPLTSR;NSSYFVEWIPNNVK;SGPFGQIFRPDNFVFGQSGAGNNWAK;IMNTFSVVPSPK;YLTVAAVFR;YLTVAAVFRGRMSMK;ALTVPELTQQVFD 5.94E+00 (AILVDLEPGTMDSVR;EVDEQMLNVQNK;FPGQLNADLR;GHYTEGAELVDSVLDVVR;ISEQFTAMFR;LAVNMVPFPR;LHFFMPGFAPLTSR;NSSYFVEWIPNNVK;SGPFGQIFRPDNFVFGQSGAGNNWAK;IMNTFSVVPSPK;YLTVAAVFR;YLTVAAVFRGRMSMK;ALTVPELTQQVFD 9.46E-01 (FWEVISDEHGIDPTGTYHGDSDLQLDR;GHYTEGAELVDSVLDVVR;NSSYFVEWIPNNVK;ALTVPELTQQVFDAK;ISVYYNEATGGK;SGPFGQIFRPDNFVFGQSGAGNNWAK) 1 IPI00011654.2
620 IPI00011730.3 EMILIN-3 precursor Cyto(G2) - 1.12E-02 (VQLLDKVHGLALGHEAHLQRLR;DDLLDCQAQLAEQVR) - - - - 1 IPI00011730.3
621 IPI00011770.1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4 Mito(SP,GO,MitoP2) 3.12E+00 (LALFNPDVCWDR;FYSVNVDYSK) - - - 2.78E-01 (FYSVNVDYSK;HPSLIPLFVFIGTGATGATLYLLR) 1.65E-01 (LALFNPDVCWDR;FYSVNVDYSK) 1 IPI00011770.1
622 IPI00011791.3 24 kDa protein Cyto(G2) - 4.26E-02 (AYLQQLR;DTDIVDEANYYFK) - - - - 1 IPI00011791.3
623 IPI00011836.2 Isoform UNPEL of Ubiquitin carboxyl-terminal hydrolase 4 Cyto(SP,GO); Nucl(GO) - - - - 1.51E-02 (LCENSDPTNVLSCHFSK;DEYEAEINRDNPLGMK) 2.69E-02 (DEYEAEINRDNPLGMK;EQLSETEGSGEDEPGNDPSETTQK) 4 IPI00011836.2, IPI00216257.2, IPI00796905.1, IPI00797542.1
624 IPI00011875.1 Protein Red Nucl(SP) - - - - - 2.50E-02 (LTQILSYLR;DKEEEELMEKPQK) 1 IPI00011875.1
625 IPI00011876.1 S-methyl-5-thioadenosine phosphorylase Cyto(G1,SP) - 2.34E-01 (EEGCTHVIVTTACGSLR;IGIIGGTGLDDPEILEGR;YVDTPFGKPSDALILGK;EEIQPGDIVIIDQFIDR;PSDALILGK;SLLLTTIPQIGSTEWSETLHNLK) - - - - 1 IPI00011876.1
626 IPI00011898.2 Translation initiation factor eIF-2B subunit epsilon Cyto(G1,GO) - 1.62E-01 (AADHLEALAAIEDFFLEHEALGISMAK;GKEENISCDNLVLEINSLK;VFQNEVLGTLQR;FAFPLSLFQGSSDGVEVR;GAEEEPPPPLQAVLVADSFDR;PTSLNVVRIITSELYR;YDLLDCHISICSPQVAQLFTDNFDYQTR) - - - - 1 IPI00011898.2
627 IPI00011913.1 Heterogeneous nuclear ribonucleoprotein A0 Nucl(G1,GO,HPA) - 3.62E-02 (LFIGGLNVQTSESGLR;GDVAEGDLIEHFSQFGTVEK) - - - 1.86E+00 (IFVGGIK;GDVAEGDLIEHFSQFGTVEK;LFIGGLNVQTSESGLR;GFGFVYFQNHDAADK;GHFEAFGTLTDCVVVVNPQTK) 1 IPI00011913.1
628 IPI00011916.1 Multisynthetase complex auxiliary component p38 Cyto(G1,GO) - 1.79E-01 (DIVINANPASPPLSLLVLHR;FLFSLFGQK;SCENLAPFNTALK;SYGPAPGAGHVQEESNLSLQALESR) - - - - 1 IPI00011916.1
629 IPI00011937.1 Peroxiredoxin-4 ER(G1); Cyto(SP,HPA) 9.82E-01 (DYGVYLEDSGHTLR;GLFIIDDK;IPLLSDLTHQISK;LVQAFQYTDK;QITLNDLPVGR;PAPYWEGTAVIDGEFK;ISKPAPYWEGTAVIDGEFK) 2.10E-01 (GLFIIDDK;DYGVYLEDSGHTLR;IPLLSDLTHQISK;LVQAFQYTDK;QITLNDLPVGR;TREEECHFYAGGQVYPGEASR;VSVADHSLHLSK) - 2.17E+01 (GLFIIDDK;GLFIIDDKGILR;DYGVYLEDSGHTLR;IPLLSDLTHQISK;IPLLSDLTHQISKDYGVYLEDSGHTLR;LVQAFQYTDK;QGGLGPIRIPLLSDLTHQISK;QITLNDLPVGR;PAPYWEGTAVIDGEFK;ISKPAPYWEGTAVIDGEFK;TREEECHFYAGGQVYPGEASR;VSVADHS 1.36E+01 (GLFIIDDK;DYGVYLEDSGHTLR;IPLLSDLTHQISK;LVQAFQYTDK;QITLNDLPVGR;PAPYWEGTAVIDGEFK;ISKPAPYWEGTAVIDGEFK;VSVADHSLHLSK;PGSETIIPDPAGK) 1.58E+00 (GLFIIDDK;GLFIIDDKGILR;DYGVYLEDSGHTLR;IPLLSDLTHQISK;LVQAFQYTDK;QITLNDLPVGRSVDETLR;ISKPAPYWEGTAVIDGEFK;TREEECHFYAGGQVYPGEASR;VSVADHSLHLSK) 1 IPI00011937.1
630 IPI00011951.2 Isoform 2 of Protein KIAA0427 Cyto(SP,GO,HPA) - - - - 2.13E-02 (SLLLNMLQK;VPDEVAVETTTPQQNKMDK) - 1 IPI00011951.2
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home