Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
631 IPI00011961.1 Isoform 1 of Sialoadhesin precursor PM(G2,SP) - - - - 6.32E-02 (DGQPLQESTSATLR;LVASTLQGVGGPEGSSPR;LHAEPVPTLAFTHVAR;SSRPAALQVLYAPQDAVLSSFR) - 3 IPI00011961.1, IPI00219698.1, IPI00219699.3
632 IPI00011970.3 Isoform 1 of 3-keto-steroid reductase PM(SP); ER(GO) - - - 1.66E-01 (KSNFSLEDFQHSK;KVIHMFSTAEGLLTQGDK;SNFSLEDFQHSK;VIHMFSTAEGLLTQGDK;YATDLLSVALNR;YLSATTGFGR) - - 3 IPI00807691.1, IPI00514524.2, IPI00011970.3
633 IPI00011998.4 Breast cancer anti-estrogen resistance 1 Cyto(G2,GO) - - - 1.80E-02 (ATAPGPEGGGTLHPNPTDK;SAVGNAAHTSDRALHAKLSR) - - 4 IPI00011998.4, IPI00641339.1, IPI00645994.1, IPI00646673.1
634 IPI00012007.5 Adenosylhomocysteinase Cyto(G1,SP,GO) - 2.22E+00 (ALDIAENEMPGLMR;DGPLNMILDDGGDLTNLIHTK;FDNLYGCR;GETDEEYLWCIEQTLYFK;KLDEAVAEAHLGK;LDEAVAEAHLGK;SKFDNLYGCR;VADIGLAAWGR;VAVVAGYGDVGK;VPAINVNDSVTK;WLNENAVEK;YPQLLPGIR;YPVGVHFLPK;GISEETTTGVHNLYK;II - - 1.65E-01 (DGPLNMILDDGGDLTNLIHTK;GISEETTTGVHNLYK;KLDEAVAEAHLGK;VPAINVNDSVTK) - 1 IPI00012007.5
635 IPI00012011.5 Cofilin-1 Cyto(G1,SP,GO); Nucl(SP,GO) 1.30E-01 (KEDLVFIFWAPESAPLK;NIILEEGKEILVGDVGQTVDDPYATFVK;LGGSAVISLEGKPL) 8.29E+00 (EDLVFIFWAPESAPLK;ESKKEDLVFIFWAPESAPLK;KEDLVFIFWAPESAPLK;YALYDATYETK;AVLFCLSEDK;AVLFCLSEDKK;EILVGDVGQTVDDPYATFVK;HELQANCYEEVK;HELQANCYEEVKDR;KAVLFCLSEDKK;KNIILEEGKEILVGDVGQTVDDPYATFVK;LGGSAVI - 5.89E-01 (EILVGDVGQTVDDPYATFVK;KEDLVFIFWAPESAPLK;NIILEEGKEILVGDVGQTVDDPYATFVK;YALYDATYETK;LGGSAVISLEGKPL) 9.56E-01 (EILVGDVGQTVDDPYATFVK;KEDLVFIFWAPESAPLK;NIILEEGKEILVGDVGQTVDDPYATFVK;YALYDATYETK;LGGSAVISLEGKPL) 7.96E-01 (EILVGDVGQTVDDPYATFVK;HELQANCYEEVKDR;KEDLVFIFWAPESAPLK;YALYDATYETK;AVLFCLSEDKK) 1 IPI00012011.5
636 IPI00012048.1 Nucleoside diphosphate kinase A Cyto(SP,GO,HPA); Nucl(SP,GO) - 5.99E-01 (DRPFFAGLVK;GDFCIQVGR;GLVGEIIKR;TFIAIKPDGVQR;GLVGEIIK;FMQASEDLLK;NIIHGSDSVESAEK) - - 3.34E-01 (TFIAIKPDGVQR;VMLGETNPADSKPGTIR;DRPFFAGLVK;NIIHGSDSVESAEK) - 2 IPI00375531.2, IPI00012048.1
637 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R Cyto(SP); Nucl(SP,GO,HPA) - 3.02E-02 (HIGVCISVANNR;GFCFLEYEDHK;TGYTLDVTTGQR;DLYEDELVPLFEK;LCDSYEIRPGK;LKDYAFVHFEDR;VTEGLVDVILYHQPDDK) - 2.29E-02 (NLATTVTEEILEK;DLYEDELVPLFEK;TGYTLDVTTGQR) - 1.76E+00 (AGPIWDLR;DYAFVHFEDR;EIEGEEIEIVLAKPPDK;LCDSYEIRPGK;LKDYAFVHFEDR;TKENILEEFSK;YGGPPPDSVYSGVQPGIGTEVFVGK;DLYEDELVPLFEK;EFNEEGALSVLQQFK;GFCFLEYEDHK;KYGGPPPDSVYSGVQPGIGTEVFVGK;NLATTVTEEILEK;STAYED 1 IPI00012074.3
638 IPI00012079.1 Eukaryotic translation initiation factor 4B Nucl(G2); Cyto(GO) - 1.20E-02 (SQSSDTEQQSPTSGGGKVAPAQPSEEGPGRK;TISLTDFLAEDGGTGGGSTYVSK) - - - - 2 IPI00012079.1, IPI00439415.6
639 IPI00012094.1 Isoform Long of Probable ubiquitin carboxyl-terminal hydrolase FAF-Y Cyto(G2) - 3.36E-03 (ALTLQDLDNIWAAQAGK;CLAENAVYLCDR;FGTLNGFQILHDR;FNDYFEFPR;GDLLEGANAYHCEK;LLLTAIGYGHVR;LYSVVSQLIR;VISSVSYYTHR;EQHDALEFFNSLVDSLDEALK;FSEYLLECPSAEVR;LVGVLVHSGQASGGHYYSYIIQR;ILDYSCSQDR;ELLAFQTSEK;F - - 6.12E-03 (TQENYEGNEEVSSPQMK;AWQTFIIDLLLHCPSKTVR) - 2 IPI00744575.1, IPI00012094.1
640 IPI00012107.2 Fatty-acid amide hydrolase ER(G2); Cyto(SP,GO,HPA) - - - 6.57E-02 (ELAPEAVLFTYVGK;LQNPDLDSEALLALPLPQLVQK;VGYYETDNYTMPSPAMR) 8.46E-02 (ALDLDVVLTPMLAPALDLNAPGR;ELAPEAVLFTYVGK;LQNPDLDSEALLALPLPQLVQK;LWELQHEIEVYR) - 1 IPI00012107.2
641 IPI00012149.1 U3 small nucleolar ribonucleoprotein protein MPP10 Nucl(SP,GO,HPA) - - - - - 1.85E-01 (LDALSNFHFIPKPPVPEIK;LSLAEIYEQEYIK;TAEEENPEHVEIQK;VTFALPDDAETEDTGVLNVK) 1 IPI00012149.1
642 IPI00012199.1 CDNA: FLJ22321 fis, clone HRC05390 Nucl(G2,HPA) - 3.62E-02 (SIEKRDTLALLQK;DFARHLEEEK;QPEYSPESPR) - - - - 1 IPI00012199.1
643 IPI00012208.1 Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6- mannosyltransferase ER(G2,GO); PM(G2) - - - 3.60E-02 (EDVQPGTGMLAYTHILMEAAPGLLALYR;THAPTVLALGFMALYSLLPHK) - - 1 IPI00012208.1
644 IPI00012268.3 26S proteasome non-ATPase regulatory subunit 2 Cyto(G1) - 6.78E-01 (APVQPQQSPAAAPGGTDEKPSGK;DKAPVQPQQSPAAAPGGTDEKPSGK;LALMLNDMELVEDIFTSCK;SSTTSMTSVPKPLK;DTSLYRPALEELRR;LKEIYENMAPGENKR;CALGVFR;VQREPLLTLVK;EPLLTLVK;EWQELDDAEK;GEAIEAILAALEVVSEPFR;GTLTLCPYHSDR;S - 1.33E-01 (EDVLTLLLPVMGDSK;VGQAVDVVGQAGKPK;WLPLGLGLNHLGK;DKAPVQPQQSPAAAPGGTDEKPSGK) 9.49E-02 (EDVLTLLLPVMGDSK;GEAIEAILAALEVVSEPFR;WLPLGLGLNHLGK;MNLASSFVNGFVNAAFGQDK;DKEQELSEEDK) 3.28E-01 (APVQPQQSPAAAPGGTDEKPSGK;DKAPVQPQQSPAAAPGGTDEKPSGK;GEAIEAILAALEVVSEPFR;SGALLACGIVNSGVR;TITGFQTHTTPVLLAHGER;VQQLLHICSEHFDSK;AELATEEFLPVTPILEGFVILR;AVPLALALISVSNPR;LGSIFGLGLAYAGSNR;SFANTLVDVCAY 1 IPI00012268.3
645 IPI00012315.2 Nucleoside diphosphate kinase 3 Cyto(G1) - 3.80E-01 (LVQASEELLR;NLIHGSDSVESAR;TFLAVKPDGVQR;GDFCIEVGK;ALIGATNPADAPPGTIR) - - - - 1 IPI00012315.2
646 IPI00012322.1 cGMP-dependent protein kinase 2 Cyto(G2,GO) - - 1.82E-02 (KLITDALNKNQFLK;EGEEGSTFFILAKGK) - - - 1 IPI00012322.1
647 IPI00012340.1 Splicing factor, arginine/serine-rich 9 Nucl(SP,GO) - - - - - 1.45E+00 (LRVEFPR;EKDLEDLFYK;HGLVPFAFVR;IYVGNLPTDVR;EAGDVCYADVQK;VLVSGLPPSGSWQDLK) 1 IPI00012340.1
648 IPI00012341.1 Isoform SRP40-1 of Splicing factor, arginine/serine-rich 5 Nucl(SP,GO,HPA); Cyto(HPA) - 3.69E-02 (LNEGVVEFASYGDLK;DADDAVYELDGK) - - - 5.50E-02 (LNEGVVEFASYGDLK;DADDAVYELDGK;LIVENLSSR) 2 IPI00555857.1, IPI00012341.1
649 IPI00012345.2 Isoform SRP55-1 of Splicing factor, arginine/serine-rich 6 Nucl(SP,GO,HPA) - 5.73E-02 (NGYGFVEFEDSR;ALDKLDGTEINGR;TNEGVIEFR;DADDAVYELNGK) - - - 7.75E-01 (LIVENLSSR;NGYGFVEFEDSR;ALDKLDGTEINGR;DADDAVYELNGK;TNEGVIEFR) 3 IPI00556297.1, IPI00215879.1, IPI00012345.2
650 IPI00012347.6 Matrix-remodelling-associated protein 5 precursor Cyto(G2) 8.06E-03 (SWVMIEPSGAVQR;QVFGSRSLPRGPDSQR) 3.44E-03 (NAAGHTERLVSLKVGLK;WVLGDGTQIRPSQFLHGNLFVFPNGTLYIR) - 1.21E-02 (EENDHKVFYGGDLK;ADGMLHISGLSSVDAGAYRCVAR;LIAYYSEVPVK;EPETNVAEGR;YQIYQDGTLLIQK) - - 1 IPI00012347.6
651 IPI00012353.1 Mitochondrial 39S ribosomal protein L3 Mito(SP,GO,MitoP2) - 2.18E-02 (PGQYVDVTAKTIGKGFQGVMK;PGQYVDVTAKTIGK) - - - - 2 IPI00012353.1, IPI00794210.1
652 IPI00012363.2 Isoform Alpha of Metabotropic glutamate receptor 1 precursor PM(SP,GO) - - - 3.91E-02 (MYIIIAK;LGVVGEFSLIGSDGWADR;SPGRKVLLAGASSQR) 2.10E-02 (SPGRKVLLAGASSQR;MYIIIAK) - 3 IPI00012363.2, IPI00184484.5, IPI00514867.1
653 IPI00012382.2 U1 small nuclear ribonucleoprotein A Nucl(SP,GO) - - - - - 4.95E+00 (SLYAIFSQFGQILDILVSR;GQAFVIFK;HDIAFVEFDNEVQAGAAR;PNHTIYINNLNEK) 1 IPI00012382.2
654 IPI00012441.1 Isoform 1 of Synaptojanin-1 Cyto(G2); Nucl(G2) - 5.71E-03 (SPDWIKNLEEEMSLEK;EMEAPKSPGTTRK) - - - - 2 IPI00012441.1, IPI00333134.2
655 IPI00012442.1 Ras-GTPase-activating protein-binding protein 1 Nucl(G2,SP); Cyto(SP,GO,HPA); PM(SP) - 8.16E-02 (DFFQSYGNVVELR;LPNFGFVVFDDSEPVQK;SELKDFFQSYGNVVELR;HPDSHQLFIGNLPHEVDK;HPDSHQLFIGNLPHEVDKSELK;GGLGGGMRGPPR) - - - - 2 IPI00012442.1, IPI00442863.1
656 IPI00012450.4 N-myc-interactor Cyto(SP,GO,HPA); Nucl(GO,HPA) - - - 8.24E-02 (GQALITFEKEEVAQNVVSMSK;VTVSPYTEIHLK;DVNLEVTAKPVPLNSGVR;INVTEIPDTLR) - - 1 IPI00012450.4
657 IPI00012490.1 Isoform XD of Plasma membrane calcium-transporting ATPase 4 PM(SP,GO) 3.39E-02 (EASDIILTDDNFTSIVK;QVVAVTGDGTNDGPALK;YGDLLPADGILIQGNDLK;SMSTVIRNPNGGFRMYSK) - - - - - 8 IPI00217171.1, IPI00217170.1, IPI00217169.1, IPI00217168.1, IPI00217166.1, IPI00217165.1, IPI00217164.1, IPI00012490.1
658 IPI00012500.1 Isoform 1 of Fanconi anemia group J protein Nucl(SP,GO); Cyto(GO) - - - - - 1.15E-02 (KQASIYRDENDDFQVEK;DFTNNDMNQGTSRHFNYPSTPPSER) 2 IPI00012500.1, IPI00514398.1
659 IPI00012510.2 EMILIN-2 precursor Nucl(G1) - - - - - 1.54E-02 (EFLEYHR;TLSPTGTAQPSWGVDPKEGPQELQEKK) 1 IPI00012510.2
660 IPI00012512.1 Ras-related protein R-Ras2 Cyto(G2) - - - - 1.00E-01 (LDILDTAGQEEFGAMR;DRDEFPMILIGNK;MNVDQAFHELVR;GSFEEIYK) - 1 IPI00012512.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home