Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
661 IPI00012535.1 DnaJ homolog subfamily A member 1 Cyto(G1); Mito(MitoP2) - 1.04E-01 (ITFHGEGDQEPGLEPGDIIIVLDQK;TIVITSHPGQIVK;VNFPENGFLSPDK;QISQAYEVLSDAK;NVVHQLSVTLEDLYNGATR) - 2.21E-01 (ITFHGEGDQEPGLEPGDIIIVLDQK;TIVITSHPGQIVK;VNFPENGFLSPDK;QISQAYEVLSDAK;HYNGEAYEDDEHHPR;ETTYYDVLGVK) 6.32E-02 (EGGAGGGFGSPMDIFDMFFGGGGR;TIVITSHPGQIVK;ITFHGEGDQEPGLEPGDIIIVLDQK;NVVHQLSVTLEDLYNGATR) 7.50E-02 (ITFHGEGDQEPGLEPGDIIIVLDQK;TIVITSHPGQIVK;VNFPENGFLSPDK) 1 IPI00012535.1
662 IPI00012545.1 Isoform TGN51 of Trans-Golgi network integral membrane protein 2 precursor PM(SP); Nucl(GO,HPA) 5.83E-02 (SGSEAQTTKDSTSK;DSSNKSGAEAQTPK) - - - 2.51E-02 (EEKEKMSGSASSENR;FVVALVLLNVAAAGAVPLLATESVK) - 3 IPI00012545.1, IPI00219049.1, IPI00297543.1
663 IPI00012555.2 Ficolin-1 precursor Nucl(G1) - - - - - 5.27E-02 (VDLVDFEGNHQFAK;LVLGAFVGGSAGNSLTGHNNNFFSTK) 1 IPI00012555.2
664 IPI00012574.2 Isoform 2 of Sodium-dependent phosphate transport protein 3 Nucl(G1); PM(GO) - - - - - 7.98E-02 (LDKQNFKTGPK;YGLALIMHFSNFTMITQR) 2 IPI00012574.2, IPI00479261.1
665 IPI00012575.1 Pirin Nucl(SP,GO); Cyto(SP,GO) - 6.25E-02 (IEPHHTAVLGEGDSVQVENK;KVTLSVLSR;NLDPFLLFDEFK;TPTLYLDFK) - - - - 1 IPI00012575.1
666 IPI00012578.1 Importin alpha-4 subunit Cyto(G1) - 8.97E-02 (DAQVVQVVLDGLSNILK;IEQLQNHENEDIYK;VQNTSLEAIVQNASSDNQGIQLSAVQAAR;SGILPILVHCLER;AVGNIVTGTDEQTQVVLNCDALSHFPALLTHPK) - - - 5.38E-02 (IEQLQNHENEDIYK;DAQVVQVVLDGLSNILK) 1 IPI00012578.1
667 IPI00012585.1 Beta-hexosaminidase beta chain precursor ER(G2) - 9.96E-02 (EISEVFPDQFIHLGGDEVEFK;FNVLHWHIVDDQSFPYQSITFPELSNK;GSYSLSHVYTPNDVR;VLDIIATINK) - - - - 1 IPI00012585.1
668 IPI00012726.4 Isoform 1 of Polyadenylate-binding protein 4 Cyto(SP,GO) - 1.26E-01 (ALYDTFSAFGNILSCK;GFGFVCFSSPEEATK;ITGMLLEIDNSELLHMLESPESLR;PLYVALAQR;SLGYAYVNFQQPADAER;AKEFTNVYIK;LFPLIQTMHSNLAGK;SKVDEAVAVLQAHHAK;FSPAGPVLSIR;NFGEEVDDESLKELFSQFGK;NLDDTIDDEKLR) - - - - 4 IPI00642944.1, IPI00642904.1, IPI00555747.1, IPI00012726.4
669 IPI00012728.1 Isoform 1 of Long-chain-fatty-acid--CoA ligase 1 Mito(G1,MitoP2); ER(GO) 1.23E+01 (AELSLVFVDKPEK;AILEDMVR;ATENTVNPCPDDTLISFLPLAHMFER;DGWLHTGDIGK;GFEGSFEELCR;GIQVSNNGPCLGSR;GITLHPELFSIDNGLLTPTMK;IFGQANTTLK;IGFFQGDIR;IIVVMDAYGSELVER;KPDQPYEWLSYK;KPKPPAPEDLAVICFTSGTTGNPK;LAQG 1.77E+00 (AELSLVFVDKPEK;ATENTVNPCPDDTLISFLPLAHMFER;GITLHPELFSIDNGLLTPTMK;IGFFQGDIR;IIVVMDAYGSELVER;LAQGEYIAPEK;LLLEGVENK;QVAELSECIGSALIQK;TAEALDKDGWLHTGDIGK;VLQPTVFPVVPR;GFEGSFEELCR;GIQVSNNGPCLGSR;KPD 5.62E+00 (AELSLVFVDKPEK;DSGLKPFEQVK;IGFFQGDIR;LLLEGVENK;SALLDSDEPLVYFYDDVTTLYEGFQR;QVAELSECIGSALIQK;TAEALDKDGWLHTGDIGK;VLQPTVFPVVPR;GFEGSFEELCR;GIQVSNNGPCLGSR;IFGQANTTLK;KPDQPYEWLSYK;KPKPPAPEDLAVICFTS 7.04E+00 (AELSLVFVDKPEK;AILEDMVR;DGWLHTGDIGK;GITLHPELFSIDNGLLTPTMK;IFGQANTTLK;IGFFQGDIR;IIVVMDAYGSELVER;KAILEDMVR;KPDQPYEWLSYK;LAQGEYIAPEK;LLLEGVENK;LMVTGAAPVSATVLTFLR;MPELVDFR;RSALLDSDEPLVYFYDDVTTLYE 6.59E+00 (AELSLVFVDKPEK;AILEDMVR;GITLHPELFSIDNGLLTPTMK;IFGQANTTLK;IGFFQGDIR;IIVVMDAYGSELVER;KAILEDMVR;KPDQPYEWLSYK;LAQGEYIAPEK;LLLEGVENK;LMVTGAAPVSATVLTFLR;MPELVDFR;SALLDSDEPLVYFYDDVTTLYEGFQR;SQIDDLYS 5.08E-01 (AELSLVFVDKPEK;IGFFQGDIR;QVAELSECIGSALIQK;TAEALDKDGWLHTGDIGK;VLQPTVFPVVPR;GFEGSFEELCR;GIQVSNNGPCLGSR;KPDQPYEWLSYK;SALLDSDEPLVYFYDDVTTLYEGFQR;SQIDDLYSTIKV;LLLEGVENK;DSGLKPFEQVK;SQIDDLYSTIK;GPN 1 IPI00012728.1
670 IPI00012750.3 40S ribosomal protein S25 Cyto(G1,GO,HPA); Nucl(GO) - 4.72E-01 (LITPAVVSER;AALQELLSK;DKLNNLVLFDK) - 4.28E-01 (AALQELLSK;DKLNNLVLFDK;LNNLVLFDK) 3.76E-01 (AALQELLSK;DKLNNLVLFDK;LITPAVVSER) - 4 IPI00740757.1, IPI00478694.1, IPI00401105.1, IPI00012750.3
671 IPI00012756.1 Interferon-induced protein with tetratricopeptide repeats 5 Cyto(G2) - 1.53E-02 (IDPENAEFLTALCELR;LQDVHAEAEGEKYIEEILDQISSQPYVLR) - - - - 1 IPI00012756.1
672 IPI00012795.3 Eukaryotic translation initiation factor 3 subunit 2 Cyto(G2,GO) - 6.62E-02 (DPIVNVWYSVNGER;GHFGPINSVAFHPDGK;LFDSTTLEHQK;IHYFDPQYFEFEFEA) - 9.35E-02 (GHFGPINSVAFHPDGK;TERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTR;IHYFDPQYFEFEFEA;LFDSTTLEHQK) - - 1 IPI00012795.3
673 IPI00012828.3 3-ketoacyl-CoA thiolase, peroxisomal precursor Nucl(G1) 1.83E+00 (AEELGLPILGVLR;SKAEELGLPILGVLR;DGSTTAGNSSQVSDGAAAILLAR;DTTPDELLSAVMTAVLK;IAQFLSDIPETVPLSTVNR) 1.32E+00 (AEELGLPILGVLR;AGLTVSDVDIFEINEAFASQAAYCVEK;VNPLGGAVALGHPLGCTGAR;QVITLLNELK;SKAEELGLPILGVLR;SYAVVGVPPDIMGIGPAYAIPVALQK;DTTPDELLSAVMTAVLK;DVNLRPEQLGDICVGNVLQPGAGAIMAR;GCFQAEIVPVTTTVHDDK;GCFQAEI 1.40E-01 (VNPLGGAVALGHPLGCTGAR;SKAEELGLPILGVLR;AEELGLPILGVLR;IAQFLSDIPETVPLSTVNR) 9.39E-01 (AEELGLPILGVLR;SKAEELGLPILGVLR;SYAVVGVPPDIMGIGPAYAIPVALQK;DGSTTAGNSSQVSDGAAAILLAR;SITVTQDEGIRPSTTMEGLAK;KDGSTTAGNSSQVSDGAAAILLAR;DTTPDELLSAVMTAVLK;GGFKDTTPDELLSAVMTAVLK;IAQFLSDIPETVPLSTVNR) 5.42E-01 (AEELGLPILGVLR;SKAEELGLPILGVLR;SYAVVGVPPDIMGIGPAYAIPVALQK;DGSTTAGNSSQVSDGAAAILLAR;DTTPDELLSAVMTAVLK;GGFKDTTPDELLSAVMTAVLK;IAQFLSDIPETVPLSTVNR) 6.76E+00 (AEELGLPILGVLR;VNPLGGAVALGHPLGCTGAR;QVITLLNELK;SKAEELGLPILGVLR;DTTPDELLSAVMTAVLK;GCFQAEIVPVTTTVHDDK;GGFKDTTPDELLSAVMTAVLK;IAQFLSDIPETVPLSTVNR;QCSSGLQAVASIAGGIR;DGSTTAGNSSQVSDGAAAILLAR;KDGSTTA 1 IPI00012828.3
674 IPI00012833.1 Serine/threonine-protein phosphatase 4 catalytic subunit Nucl(G1,SP); Cyto(SP) - 4.49E-02 (IFCVHGGLSPSIQTLDQIR;EILVEESNVQR) - - - 5.38E-02 (DFIIFEAAPQETR;IFCVHGGLSPSIQTLDQIR) 1 IPI00012833.1
675 IPI00012834.4 Isoform Gamma-3 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform Nucl(SP,GO) - 1.40E-02 (FLESPDFQPNIAK;SLSVYHPQLAYCVVQFLEK;FVLQLLELFDSEDPR) - - - - 6 IPI00442098.1, IPI00384127.1, IPI00303213.1, IPI00220145.4, IPI00185637.2, IPI00012834.4
676 IPI00012835.1 C-terminal-binding protein 1 Cyto(SP); Nucl(SP,GO,HPA) - 7.51E-02 (SAGDLGIAVCNVPAASVEETADSTLCHILNLYR;GAALDVHESEPFSFSQGPLK;PLVALLDGR) - - - - 2 IPI00012835.1, IPI00554626.3
677 IPI00012837.1 Kinesin heavy chain Cyto(G2) - 8.05E-02 (ANLEAFTVDKDITLTNDKPATAIGVIGNFTDAER;ISFLENNLEQLTK;PIRPGQHPAASPTHPSAIR;SLSALGNVISALAEGSTYVPYR;TGAEGAVLDEAK;TKEYELLSDELNQK;GGGAFVQNSQPVAVR;ILQDSLGGNCR;QLDDKDEEINQQSQLVEK;EYELLSDELNQK;FQGEDTVVIA - 1.94E-02 (FQGEDTVVIASKPYAFDR;SLTEYLQNVEQK;ISFLENNLEQLTK;GGGAFVQNSQPVAVR) - - 2 IPI00012837.1, IPI00472558.1
678 IPI00012842.1 Pendrin PM(G2,GO) - - - 2.56E-02 (LLEPLQKSVLAAVVIANLK;TQVAGIISAAIVMIAILALGK) - - 1 IPI00012842.1
679 IPI00012855.1 Transmembrane protein 11 PM(G1); Mito(GO) 1.34E-01 (LPLHTLTSSTPVVLVR;YIVIEPTR) - - - - - 2 IPI00012855.1, IPI00793710.1
680 IPI00012866.2 RAC-alpha serine/threonine-protein kinase Cyto(G2,SP,GO,HPA); Nucl(SP,GO,HPA); PM(SP,GO) - 3.09E-02 (FFAGIVWQHVYEK;FYGAEIVSALDYLHSEK) - - - - 1 IPI00012866.2
681 IPI00012870.1 RAC-beta serine/threonine-protein kinase Cyto(G2,GO); Nucl(GO) - 3.74E-02 (FYGAEIVSALEYLHSR;LPFYNQDHER;TLSPEAKSLLAGLLKK;YFDDEFTAQSITITPPDR) - - - - 3 IPI00012870.1, IPI00784816.1, IPI00797102.1
682 IPI00012887.1 Cathepsin L precursor Cyto(G2) - - - - 5.49E-02 (AVATVGPISVAIDAGHESFLFYK;VFQEPLFYEAPR) - 1 IPI00012887.1
683 IPI00012891.1 Phosphorylase b kinase gamma catalytic chain, testis/liver isoform Cyto(G2,GO) - 5.90E-02 (LTAEQALQHPFFER;HLIDNCAFR;ATGHEFAVK;KGELFDYLTEK;SLLEAVSFLHANNIVHR) - - - - 1 IPI00012891.1
684 IPI00012912.1 Carnitine O-palmitoyltransferase 2, mitochondrial precursor Mito(SP,GO,MitoP2) 3.65E-01 (AGLLEPEVFHLNPAK;ALEDMFDALEGK;DSTQTPAVTPQSQPATTDSTVTVQK;ELHEQLVALDK;GNFYIFDVLDQDGNIVSPSEIQAHLK;YILSDSSPAPEFPLAYLTSENR;YLSAQKPLLNDGQFR;FFNEVFK;LNFELTDALK) 3.25E-02 (LSPDAVAQLAFQMAFLR;YILSDSSPAPEFPLAYLTSENR;TLTIDCVQFQR;GNFYIFDVLDQDGNIVSPSEIQAHLK) 1.37E+00 (ELHEQLVALDK;GNFYIFDVLDQDGNIVSPSEIQAHLK;LNFELTDALK;LSPDAVAQLAFQMAFLR;SFNLIIAK;TLTIDCVQFQR;YILSDSSPAPEFPLAYLTSENR;AGLLEPEVFHLNPAK;KGNFYIFDVLDQDGNIVSPSEIQAHLK;KVDSAVFCLCLDDFPIK;YLSAQKPLLNDGQFR; 2.75E-02 (AGLLEPEVFHLNPAK;LNFELTDALK;SIVPTMHYQDSLPR) - 4.67E-02 (ELHEQLVALDK;GNFYIFDVLDQDGNIVSPSEIQAHLK;YILSDSSPAPEFPLAYLTSENR;LNFELTDALK) 1 IPI00012912.1
685 IPI00012970.1 Serine/threonine-protein phosphatase 6 Cyto(SP,GO) - 1.21E-01 (GAFCDLVWSDPEDVDTWAISPR;LVTVWSAPNYCYR;VTNEFVHINNLK;GYYSLETFTYLLALK) - - - - 1 IPI00012970.1
686 IPI00012989.2 Lysosomal alpha-mannosidase precursor Cyto(G2) - - 1.42E-02 (ELVDYFLNVATAQGR;EQASLFAQMGFDGFFFGR) - - - 2 IPI00012989.2, IPI00644131.1
687 IPI00013004.1 Isoform 1 of Pyridoxal kinase Cyto(SP,GO) - 6.15E-01 (KVDAVFVGTGDLFAAMLLAWTHK;GQVLNSDELQELYEGLR;SFLAMVVDIVQELK;VVPLADIITPNQFEAELLSGR;YDYVLTGYTR;AATFPLQVLGFEIDAVNSVQFSNHTGYAHWK;LVYVCDPVLGDK;WDGEGSMYVPEDLLPVYK;VLSIQSHVIR;AQAGEGVRPSPMQLELR) - - - - 1 IPI00013004.1
688 IPI00013068.1 Eukaryotic translation initiation factor 3 subunit 6 Cyto(SP,GO,HPA); Nucl(SP,GO,HPA) - 1.32E-01 (ETIDNNSVSSPLQSLQQR;MFEDPETTR;NLYSDDIPHALR;HLVFPLLEFLSVK;LFIFETFCR;FQYECGNYSGAAEYLYFFR;LNMTPEEAER;QLQAETEPIVK) - 2.49E-02 (NLYSDDIPHALR;LGHVVMGNNAVSPYQQVIEK) - - 1 IPI00013068.1
689 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 Nucl(SP,GO) - 2.18E-02 (SSGYPLTIEGFAYLWSGAR;WDVLIQQATQCLNR;HLPSTEPDPHVVR) - - - 4.42E-01 (ANFTLPDVGDFLDEVLFIELQR;EALGGQALYPHVLVK;NCAVEFNFGQR;NYILDQTNVYGSAQR;SSGYPLTIEGFAYLWSGAR;WDVLIQQATQCLNR;QGAPTSFLPPEASQLKPDR;HLPSTEPDPHVVR;SGGGGYSQNRWGNNNR) 3 IPI00013070.2, IPI00167147.1, IPI00736859.1
690 IPI00013079.1 EMILIN-1 precursor Nucl(G1) - - - - - 4.19E-02 (LRAMEKLLASVEER;VQQLEEQVQSLTK;LVGSGLHTVEAAGEAR;APAPASAPPGPSEELLR) 1 IPI00013079.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home