Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
691 IPI00013122.1 Hsp90 co-chaperone Cdc37 Cyto(SP,GO,HPA) - 1.40E-01 (EGEEAGPGDPLLEAVPK;LGPGGLDPVEVYESLPEELQK) - - - - 1 IPI00013122.1
692 IPI00013146.1 Mitochondrial 28S ribosomal protein S22 Mito(SP,GO,MitoP2,HPA) 4.81E-02 (YFGGMVWYFVNNKK;VPINDVLAEDK) - - - - - 1 IPI00013146.1
693 IPI00013163.1 Myeloid cell nuclear differentiation antigen Nucl(SP,GO,HPA); Cyto(SP,GO,HPA) - - - - - 8.14E-02 (EASSVSDFNQNFEVPNR;SLLAYDLGLTTK) 1 IPI00013163.1
694 IPI00013174.2 Isoform 1 of RNA-binding protein 14 Nucl(SP,GO,HPA) - - 2.60E-02 (IFVGNVSAACTSQELR;KGPGLAVQSGDKTK) - - 1.22E+00 (IFVGNVSAACTSQELR;AIEALHGHELRPGR;KPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQAR;ASYVAPLTAQPATYR;TQSSASLAASYAAQQHPQAAASYR;LAELSDYR;AQPSVSLGAAYR;LSESQLSFR;AQPSASLGVGYR;YSGSYNDYLR) 1 IPI00013174.2
695 IPI00013183.7 ubiquitin-activating enzyme E1-like Cyto(G1,GO) - 1.67E-01 (AEASQELLAQLNR;APASAAASEDAPYPVCTVR;GLNPDLQVIPLTYPLDPTTEHIYGDNFFSR;HSYLHLAENYLIR;SRAEASQELLAQLNR;TEEEPLEEPLDEALVR;TLESLLAHLQEQHGLR;VLVSGLQGLGAEVAK;YDGQIAVFGAGFQEK;HGVCFLAADTR;LLDEELYSR;HEFEELF - 1.75E-02 (SRAEASQELLAQLNR;KGANTHYFR) - - 1 IPI00013183.7
696 IPI00013185.8 Isoform 1 of Jumonji/ARID domain-containing protein 1C Nucl(SP) - - - - - 1.04E-02 (DKEGPECPPTVVVK;VRAESFDTWANK) 3 IPI00013185.8, IPI00219412.2, IPI00640875.2
697 IPI00013193.3 Isoform 1 of Myosin-7A Cyto(G2,GO) 8.57E-03 (TLITRGETVSTPLSR;ELCNALADKISLK) - - - 8.33E-03 (SVNELTDQIFEGPLKAEPLK;TLITRGETVSTPLSR;TLLTDSATTAK) - 5 IPI00013193.3, IPI00215753.3, IPI00215756.3, IPI00215758.3, IPI00215759.1
698 IPI00013215.2 Origin recognition complex subunit 1 Nucl(SP,GO,HPA); Cyto(GO,HPA); PM(GO,HPA) - - - 1.29E-02 (LKHLKAFEDDAIQLVAR;KVAFSEITSPSK) - - 1 IPI00013215.2
699 IPI00013269.1 Isoform 1 of Protein C6orf106 Nucl(G1) - - - - - 1.98E-01 (VEGNFNPFASPQK;DVLISEFQR) 2 IPI00013269.1, IPI00332642.6
700 IPI00013271.1 Derlin-1 ER(SP,GO,HPA) 1.93E-01 (LGLISPAYLFLWPEAFLYR;NFLSTPQFLYR) - - 7.78E-02 (LGLISPAYLFLWPEAFLYR;NFLSTPQFLYR) 2.50E-01 (NFLSTPQFLYR;YWFAATVAVPLVGK) 9.90E-02 (NFLSTPQFLYR;LGLISPAYLFLWPEAFLYR) 1 IPI00013271.1
701 IPI00013290.5 hepatoma-derived growth factor-related protein 2 isoform 1 Nucl(G1) - - - - - 3.20E-02 (YPIFFFGTHETAFLGPK;AEDKPSTDLSAPVNGEATSQK) 2 IPI00645387.1, IPI00013290.5
702 IPI00013296.2 40S ribosomal protein S18 Cyto(SP,GO) - 7.96E-01 (IAFAITAIK;IPDWFLNR;YSQVLANGLDNK;AGELTEDEVER) - - - - 1 IPI00013296.2
703 IPI00013297.1 28 kDa heat- and acid-stable phosphoprotein ER(G1) - - - 1.62E-01 (GVEGLIDIENPNR;QYTSPEEIDAQLQAEK;SLDSDESEDEEDDYQQK) 5.80E-02 (KGVEGLIDIENPNR;SLDSDESEDEEDDYQQK) - 1 IPI00013297.1
704 IPI00013323.4 Cytochrome P450 2C19 ER(SP,GO) 5.97E-02 (DFIDCFLIK;YALLLLLK;DQQFLNLMEK;EALIDLGEEFSGR;FDYKDQQFLNLMEK;GFGIVFSNGK;RFSLMTLR;FSLMTLR;LPPGPTPLPVIGNILQIDIKDVSK;LPPGPTPLPVIGNILQIDIK) - - 5.18E-01 (DQQFLNLMEK;EALIDLGEEFSGR;FDYKDQQFLNLMEK;FSLMTLR;GFGIVFSNGK;RFSLMTLR;VQEEARCLVEELR;YALLLLLK;YALLLLLKHPEVTAK;SIEDRVQEEAR;GHMPYTDAVVHEVQR;HFLDEGGNFK;GTTILTSLTSVLHDNK;EFPNPEMFDPR;GTTILTSLTSVLHDN 4.15E-01 (VQEEARCLVEELR;DQQFLNLMEK;EALIDLGEEFSGR;EKQNQQSEFTIENLVITAADLLGAGTETTSTTLR;FDYKDQQFLNLMEK;GFGIVFSNGK;GHMPYTDAVVHEVQR;IYGPVFTLYFGLER;LPPGPTPLPVIGNILQIDIK;NLAFMESDILEK;RFSLMTLR;YALLLLLK;YALLLLL - 1 IPI00013323.4
705 IPI00013415.1 40S ribosomal protein S7 Cyto(G1,GO); Nucl(GO) - 1.17E+00 (AIIIFVPVPQLK;DVNFEFPEFQL;VETFSGVYK;KAIIIFVPVPQLK;IVKPNGEKPDEFESGISQALLELEMNSDLK;TLTAVHDAILEDLVFPSEIVGK) - 1.74E+00 (AIIIFVPVPQLK;DVNFEFPEFQL;VETFSGVYK;LTGKDVNFEFPEFQL;KAIIIFVPVPQLK;IVKPNGEKPDEFESGISQALLELEMNSDLK;TLTAVHDAILEDLVFPSEIVGK;TLTAVHDAILEDLVFPSEIVGKR) 1.23E+00 (AIIIFVPVPQLK;DVNFEFPEFQL;VETFSGVYK;KAIIIFVPVPQLK;IVKPNGEKPDEFESGISQALLELEMNSDLK;TLTAVHDAILEDLVFPSEIVGK) 1.82E-01 (AIIIFVPVPQLK;KAIIIFVPVPQLK;TLTAVHDAILEDLVFPSEIVGK) 1 IPI00013415.1
706 IPI00013452.8 glutamyl-prolyl tRNA synthetase Cyto(G1,GO) - 4.36E-01 (AALLNQHYQVNFK;ERPTPSLNNNCTTSEDSLVLYNR;AYVDDTPAEQMK;DDVSISVEEGK;DQVDIAVQELLQLK;EAPCVLIYIPDGHTK;ENILHVSENVIFTDVNSILR;EYIPGQPPLSQSSDSSPTR;FAGGDYTTTIEAFISASGR;GNAAWQEQLK;GSQFGQSCCLR;INEAVECLLSLK - - - - 1 IPI00013452.8
707 IPI00013459.1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial precursor Mito(G1,SP,GO,MitoP2,HPA) 4.53E-01 (GDGPWYYYETIDK;GDGPWYYYETIDKELIDHSPK;LFVIRPSR) - 1.42E-01 (GDGPWYYYETIDK;GDGPWYYYETIDKELIDHSPK) 1.21E-01 (TMAVLQIEAEK;TMAVLQIEAEKAELR;VSVTAVAALSGRPLGTR) - - 2 IPI00013459.1, IPI00791036.1
708 IPI00013468.1 Mitotic checkpoint protein BUB3 Nucl(SP,GO,HPA); Cyto(GO) - - - - - 1.21E+00 (FSPNTSQFLLVSSWDTSVR;LNQPPEDGISSVK;YQHTGAVLDCAFYDPTHAWSGGLDHQLK;TPCNAGTFSQPEK;QGYVLSSIEGR;VAVEYLDPSPEVQK;VYTLSVSGDR) 3 IPI00013468.1, IPI00514701.1, IPI00644108.1
709 IPI00013475.1 Tubulin beta-2A chain Cyto(G1) 2.20E-01 (AILVDLEPGTMDSVR;EIVHIQAGQCGNQIGAK;FPGQLNADLR;GHYTEGAELVDSVLDVVR;ISEQFTAMFR;SGPFGQIFRPDNFVFGQSGAGNNWAK;LAVNMVPFPR;LHFFMPGFAPLTSR;NSSYFVEWIPNNVK;MSATFIGNSTAIQELFK;LTTPTYGDLNHLVSATMSGVTTCLR;INV 2.95E-01 (LAVNMVPFPR;FPGQLNADLR;KLAVNMVPFPR;LHFFMPGFAPLTSR;FPGQLNADLRK;EVDEQMLNVQNK;GHYTEGAELVDSVLDVVR;NSSYFVEWIPNNVK;TAVCDIPPR;AILVDLEPGTMDSVR;EIVHIQAGQCGNQIGAK;ISEQFTAMFR;SGPFGQIFRPDNFVFGQSGAGNNWAK; - 9.91E-02 (AILVDLEPGTMDSVR;ESESCDCLQGFQLTHSLGGGTGSGMGTLLISK;EVDEQMLNVQNK;FPGQLNADLR;GHYTEGAELVDSVLDVVR;ISEQFTAMFR;LAVNMVPFPR;LHFFMPGFAPLTSR;NSSYFVEWIPNNVK;SGPFGQIFRPDNFVFGQSGAGNNWAK;MSATFIGNSTAIQELFK;I 4.58E-02 (AILVDLEPGTMDSVR;EVDEQMLNVQNK;FPGQLNADLR;GHYTEGAELVDSVLDVVR;ISEQFTAMFR;LAVNMVPFPR;LHFFMPGFAPLTSR;NSSYFVEWIPNNVK;SGPFGQIFRPDNFVFGQSGAGNNWAK;MSATFIGNSTAIQELFK;INVYYNEAAGNK) 6.75E-02 (GHYTEGAELVDSVLDVVR;NSSYFVEWIPNNVK;SGPFGQIFRPDNFVFGQSGAGNNWAK;FWEVISDEHGIDPTGSYHGDSDLQLER) 1 IPI00013475.1
710 IPI00013485.3 40S ribosomal protein S2 Cyto(G1,GO); Nucl(GO) - 1.33E+00 (AFVAIGDYNGHVGLGVK;GTGIVSAPVPK;TYSYLTPDLWK;SPYQEFTDHLVK;GCTATLGNFAK;SLEEIYLFSLPIK;ESEIIDFFLGASLK;ESEIIDFFLGASLKDEVLK;MADDAGAAGGPGGPGGPGMGNRGGFR) - 2.59E-01 (ESEIIDFFLGASLKDEVLK;SLEEIYLFSLPIK;AFVAIGDYNGHVGLGVK;SPYQEFTDHLVK) 1.57E-01 (GTGIVSAPVPK;SPYQEFTDHLVK;SLEEIYLFSLPIK) - 1 IPI00013485.3
711 IPI00013508.5 Alpha-actinin-1 Cyto(G1,SP,GO); Nucl(GO) - 1.85E+00 (ACLISLGYDIGNDPQGEAEFAR;AGTQIENIEEDFR;AGTQIENIEEDFRDGLK;AIMTYVSSFYHAFSGAQK;ALDFIASK;TINEVENQILTR;CQLEINFNTLQTK;DDPLTNLNTAFDVAEK;DGLGFCALIHR;DYETATLSEIK;EGLLLWCQR;GISQEQMNEFR;GYEEWLLNEIR;HEAFE 1.21E-02 (LAILGIHNEVSK;LLETIDQLYLEYAK) - - - 1 IPI00013508.5
712 IPI00013621.3 Thiamine-triphosphatase Cyto(SP,GO,HPA); Nucl(GO,HPA) - 8.09E-02 (CPGAAGVLGPHTEYK;LVLLGADEEEPQLR;VDLDTADFGYAVGEVEALVHEEAEVPTALEK) - - - - 1 IPI00013621.3
713 IPI00013623.4 Isoform 1 of Long-chain fatty acid transport protein 3 ER(G1) - - - 3.14E-01 (AAPGAGDAAAGSGAEFAGGDGAAR;AGMAALVLRPPHALDLMQLYTHVSENLPPYAR;ALVLAPEFLESLEPDLPALR;GENVATTEVAEVFEALDFLQEVNVYGVTVPGHEGR;YSALLAGNLR;PPHALDLMQLYTHVSENLPPYAR;WKGENVATTEVAEVFEALDFLQEVNVYGVTVPGHEGR;TA 1.80E-01 (AAPGAGDAAAGSGAEFAGGDGAAR;ALVLAPEFLESLEPDLPALR;GENVATTEVAEVFEALDFLQEVNVYGVTVPGHEGR;YSALLAGNLR;MANEGFDPSTLSDPLYVLDQAVGAYLPLTTAR) 3.99E-02 (AAPGAGDAAAGSGAEFAGGDGAAR;ALVLAPEFLESLEPDLPALR) 1 IPI00013623.4
714 IPI00013678.2 metaxin 1 isoform 1 Mito(G1,GO,HPA); PM(G1) 4.96E-01 (ISNPWQSPSGTLPALR;LQLLTGEHRPEDEEELEKELYR;QTPAGPETEEEPYR;LLPVLVHTFWIDTK;YNADYDLSAR) - 1.05E-01 (ISNPWQSPSGTLPALR;LQLLTGEHRPEDEEELEKELYR;LLPVLVHTFWIDTK) - 4.01E-02 (LQLLTGEHRPEDEEELEKELYR;QTPAGPETEEEPYR;WYAEAMPFPLNFFLPGR) - 1 IPI00013678.2
715 IPI00013683.2 Tubulin beta-3 chain ER(G1); Cyto(SP) 5.17E-01 (AILVDLEPGTMDSVR;EIVHIQAGQCGNQIGAK;FPGQLNADLR;GHYTEGAELVDSVLDVVR;ISEQFTAMFR;LAVNMVPFPR;NSSYFVEWIPNNVK;IMNTFSVVPSPK;ALTVPELTQQMFDAK;MSSTFIGNSTAIQELFK) - - 7.60E-01 (AILVDLEPGTMDSVR;FPGQLNADLR;GHYTEGAELVDSVLDVVR;ISEQFTAMFR;LAVNMVPFPR;NSSYFVEWIPNNVK;ALTVPELTQQMFDAK;IMNTFSVVPSPK;MSSTFIGNSTAIQELFK) 3.87E-01 (AILVDLEPGTMDSVR;FPGQLNADLR;GHYTEGAELVDSVLDVVR;ISEQFTAMFR;LAVNMVPFPR;NSSYFVEWIPNNVK;ALTVPELTQQMFDAK;IMNTFSVVPSPK;MSSTFIGNSTAIQELFK) - 1 IPI00013683.2
716 IPI00013698.1 Acid ceramidase precursor PM(G1) 8.77E-01 (ESLDVYELDAK;GAVPWYTINLDLPPYK;LPGLLGNFPGPFEEEMK;WYVVQTNYDR;GQFETYLR;TSQENISFETMYDVLSTKPVLNK;STYPPSGPTYR) - - - 1.10E-01 (ASSFAGYVGMLTGFKPGLFSLTLNER;ESLDVYELDAK;LPGLLGNFPGPFEEEMK) 6.51E-02 (ESLDVYELDAK;WYVVQTNYDR;WHELMLDKAPMLKVIVNSLK) 1 IPI00013698.1
717 IPI00013723.3 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Nucl(SP,GO) - 1.38E-01 (SGEEDFESLASQFSDCSSAK;TKEEALELINGYIQK) - - - - 1 IPI00013723.3
718 IPI00013735.1 Isoform 1 of FAST kinase domain-containing protein 2 Cyto(G2); Mito(GO) - - 1.54E-02 (VAEVLSSLLGGEGHFSK;NILSILHTYSSLNHVYK) - - - 2 IPI00013735.1, IPI00479951.4
719 IPI00013744.1 Integrin alpha-2 precursor PM(G2,GO) - - - - 2.61E-02 (YEKMTKNPDEIDETTELSS;VDISLENPGTSPALEAYSETAK;ILGSDGAFR) - 1 IPI00013744.1
720 IPI00013773.2 Receptor-interacting serine/threonine-protein kinase 1 Cyto(SP,GO,HPA); Mito(GO); PM(GO) - 1.56E-02 (PFYLSQLEESVEEDVK;LQDEANYHLYGSR) - - - - 1 IPI00013773.2
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home