Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
721 IPI00013774.1 Histone deacetylase 1 Nucl(SP,GO,HPA); Cyto(GO) - - - - - 4.70E-02 (YGEYFPGTGDLR;YYAVNYPLR) 2 IPI00013774.1, IPI00514649.1
722 IPI00013788.1 HIV Tat-specific factor 1 Nucl(SP,GO,HPA) - 9.90E-03 (DGDTQTDAGGEPDSLGQQPTDTPYEWDLDK;DLDEEGSEKELHENVLDK) - - - 3.29E-01 (LFEESDDKEDEDADGKEVEDADEK;TEDGGEFEEGASENNAK;DPEEADYCIQTLDGR;GWEAFLNAPEANR;QITAQAWDGTTDYQVEETSR;ESEDDLNKESEEEVGPTK;LLDEDEIR) 1 IPI00013788.1
723 IPI00013808.1 Alpha-actinin-4 Cyto(G1,SP,GO); Nucl(SP,GO) 1.21E+00 (AGTQIENIDEDFR;AIMTYVSSFYHAFSGAQK;ALDFIASK;CQLEINFNTLQTK;DGLAFNALIHR;DYETATLSDIK;ELPPDQAEYCIAR;ETTDTDTADQVIASFK;FAIQDISVEETSAK;GYEEWLLNEIR;HEAFESDLAAHQDR;KDDPVTNLNNAFEVAEK;KHEAFESDLAAHQDR;LAS 3.37E+00 (AIMTYVSSFYHAFSGAQK;ALDFIASK;TINEVENQILTR;CQLEINFNTLQTK;EGLLLWCQR;GYEEWLLNEIR;HEAFESDLAAHQDR;KHEAFESDLAAHQDR;LASDLLEWIR;LMLLLEVISGER;TFTAWCNSHLR;ELPPDQAEYCIAR;FAIQDISVEETSAK;KTFTAWCNSHLR;VGWE - 9.35E-02 (AGTQIENIDEDFRDGLK;FAIQDISVEETSAK;GISQEQMQEFR;ISNRPAFMPSEGK;KDDPVTNLNNAFEVAEK;LASDLLEWIR;LSGSNPYTTVTPQIINSK;MAPYQGPDAVPGALDYK;TINEVENQILTR;VEQIAAIAQELNELDYYDSHNVNTR;VGWEQLLTTIAR;VLAGDKNFITAEE 1.75E-01 (AGTQIENIDEDFRDGLK;AIMTYVSSFYHAFSGAQK;ASFNHFDKDHGGALGPEEFK;DYETATLSDIK;FAIQDISVEETSAK;GISQEQMQEFR;ISNRPAFMPSEGK;LSGSNPYTTVTPQIINSK;MAPYQGPDAVPGALDYK;MLDAEDIVNTARPDEK;SIVDYKPNLDLLEQQHQLIQEALIF 4.36E-01 (ACLISLGYDVENDR;AGTQIENIDEDFRDGLK;CQLEINFNTLQTK;HRDYETATLSDIK;LSGSNPYTTVTPQIINSK;QLEAIDQLHLEYAK;ETTDTDTADQVIASFK;FAIQDISVEETSAK;KDDPVTNLNNAFEVAEK;SIVDYKPNLDLLEQQHQLIQEALIFDNK;TINEVENQILTR;VEQ 1 IPI00013808.1
724 IPI00013809.1 Maleylacetoacetate isomerase Cyto(G1,GO) - 1.54E+00 (GIDYKTVPINLIK;VDLTPYPTISSINKR;FKVDLTPYPTISSINK;FKVDLTPYPTISSINKR;LLVLEAFQVSHPCR;QPDTPTELRA;MISDLIAGGIQPLQNLSVLK;IDGITIHQSLAIIEYLEETRPTPR) 5.58E-01 (IDGITIHQSLAIIEYLEETRPTPR;VDLTPYPTISSINK;FKVDLTPYPTISSINK;FKVDLTPYPTISSINKR;LLVLEAFQVSHPCR;MISDLIAGGIQPLQNLSVLK) - 6.73E-02 (MISDLIAGGIQPLQNLSVLK;VDLTPYPTISSINK) - 1 IPI00013809.1
725 IPI00013838.1 51C protein Nucl(G2) - 7.95E-03 (PRRVCLCPASR;HECLAAGHRLGAL) - - - - 1 IPI00013838.1
726 IPI00013847.4 Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial precursor Mito(G1,SP,GO,MitoP2) 6.83E+00 (ADLTEYLSTHYK;AVELLGDIVQNCSLEDSQIEK;AVELLGDIVQNCSLEDSQIEKER;DVVFNYLHATAFQGTPLAQAVEGPSENVR;HLGGIPWTYAEDAVPTLTPCR;MVLAAAGGVEHQQLLDLAQK;EVESMGAHLNAYSTR;IAEVDASVVR;IPLAEWESR;LCTSATESEVAR;NALVSHLD - 4.16E+00 (AVELLGDIVQNCSLEDSQIEK;HLGGIPWTYAEDAVPTLTPCR;ADLTEYLSTHYK;DVVFNYLHATAFQGTPLAQAVEGPSENVR;MVLAAAGGVEHQQLLDLAQK;NALVSHLDGTTPVCEDIGR;NNGAGYFLEHLAFK;YIYDQCPAVAGYGPIEQLPDYNR;IAEVDASVVR;IPLAEWESR;LC 2.28E-01 (ADLTEYLSTHYK;MVLAAAGGVEHQQLLDLAQK;DVVFNYLHATAFQGTPLAQAVEGPSENVR;EVESMGAHLNAYSTR;IAEVDASVVR) 7.50E-01 (ADLTEYLSTHYK;DVVFNYLHATAFQGTPLAQAVEGPSENVR;MVLAAAGGVEHQQLLDLAQK;EVESMGAHLNAYSTR;IAEVDASVVR;IDDMMFVLQGQWMR;IPLAEWESR;NNGAGYFLEHLAFK;RIPLAEWESR) 6.38E-01 (DVVFNYLHATAFQGTPLAQAVEGPSENVR;HLGGIPWTYAEDAVPTLTPCR;ADLTEYLSTHYK;MVLAAAGGVEHQQLLDLAQK;AVELLGDIVQNCSLEDSQIEK;NNGAGYFLEHLAFK;YIYDQCPAVAGYGPIEQLPDYNR;IAEVDASVVR;NALVSHLDGTTPVCEDIGR) 1 IPI00013847.4
727 IPI00013862.7 Thymidylate kinase Cyto(G2,GO) - 6.12E-02 (SDVEDHSVHLLFSANR;KLVEALCAAGHR) - - - - 3 IPI00013862.7, IPI00787559.1, IPI00787828.1
728 IPI00013877.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein H3 Nucl(SP,HPA) - 6.75E-02 (ATENDIANFFSPLNPIR;STGEAFVQFASK) - - - 4.15E+00 (ATENDIANFFSPLNPIR;VHIDIGADGR;RGGDGYDGGYGGFDDYGGYNNYGYGNDGFDDR;STGEAFVQFASK;STGEAFVQFASKEIAENALGK;YIEIFR) 2 IPI00013877.2, IPI00216493.1
729 IPI00013881.6 heterogeneous nuclear ribonucleoprotein H1 Nucl(SP,GO,HPA); Cyto(GO,HPA) 1.54E-01 (HTGPNSPDTANDGFVR;STGEAFVQFASQEIAEK;ATENDIYNFFSPLNPVR) 1.02E+00 (ATENDIYNFFSPLNPVR;HTGPNSPDTANDGFVR;STGEAFVQFASQEIAEK;VHIEIGPDGR;YVEVFKSNNVEMDWVLK) 1.27E+00 (ATENDIYNFFSPLNPVR;HTGPNSPDTANDGFVR;STGEAFVQFASQEIAEK) 3.19E-02 (ATENDIYNFFSPLNPVR;YVEVFKSNNVEMDWVLK) - 1.60E+01 (ATENDIYNFFSPLNPVR;EEIVQFFSGLEIVPNGITLPVDFQGR;HTGPNSPDTANDGFVR;EGRPSGEAFVELESEDEVK;GAYGGGYGGYDDYNGYNDGYGFGSDR;GLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGR;GLPWSCSADEVQR;STGEAFVQFASQEIAEK;PSGEAFVELESEDE 2 IPI00479191.2, IPI00013881.6
730 IPI00013887.1 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase ER(G2) 7.44E-02 (FNGAPTANFQQDVGTK;WYQNPDYNFFNNYK) - - - 8.03E-02 (FNGAPTANFQQDVGTK;HLNQGTDEDIYLLGK;WYQNPDYNFFNNYK) - 1 IPI00013887.1
731 IPI00013891.1 Isoform Long of Transformer-2 protein homolog Nucl(SP,GO) - - - - - 6.07E-01 (ANPDPNTCLGVFGLSLYTTER;GFAFVYFER;YGPLSGVNVVYDQR) 2 IPI00013891.1, IPI00220447.1
732 IPI00013894.1 Stress-induced-phosphoprotein 1 Cyto(G1); Nucl(GO) - 1.65E-01 (AAALEFLNR;ALSVGNIDDALQCYSEAIK;DCEECIQLEPTFIK;ILKEQERLAYINPDLALEEK;YKDAIHFYNK;KAAALEFLNR;LAYINPDLALEEK;TYEEGLKHEANNPQLK;TVDLKPDWGK;TLLSDPTYR;LLEFQLALK) - - - - 1 IPI00013894.1
733 IPI00013905.1 5'-AMP-activated protein kinase subunit beta-2 Cyto(G1,GO); Nucl(GO) - 3.53E-01 (FFVDGQWVHDPSEPVVTSQLGTINNLIHVK;KSDFEVFDALK;LPGDKEFVSWQQDLEDSVKPTQQAR;SDFEVFDALK;SPPILPPHLLQVILNK;FKSPPILPPHLLQVILNK) - 2.10E-01 (FFVDGQWVHDPSEPVVTSQLGTINNLIHVK;IMVGSTDDPSVFSLPDSK;SHNDFVAILDLPEGEHQYK;SPPILPPHLLQVILNK) 1.13E-01 (IMVGSTDDPSVFSLPDSK;SPPILPPHLLQVILNK) 1.00E-01 (FFVDGQWVHDPSEPVVTSQLGTINNLIHVK;SPPILPPHLLQVILNK) 1 IPI00013905.1
734 IPI00013925.3 Galactose-1-phosphate uridylyltransferase Cyto(G1,GO) - 3.89E-01 (RPWQGQVEPQLLK;HDPLNPLCPGAIR;QQASEADAAAATFR;YNPLQDEWVLVSAHR;SQHGEPLLMEYSR;ALPEVHYHLGQK;ANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAK;LPELTPAER;LPELTPAERDDLASIMK) - - - - 1 IPI00013925.3
735 IPI00013930.1 Syntaxin-6 Cyto(G2); PM(GO) - - - - 5.22E-02 (ANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLK;IGGELEEQAVMLEDFSHELESTQSR) - 1 IPI00013930.1
736 IPI00013933.2 Isoform DPI of Desmoplakin PM(G1,GO); Cyto(SP) 1.33E+00 (AITGFDDPFSGK;ALLQAILQTEDMLK;AVTGYNDPETGNIISLFQAMNK;DYELQLASYTSGLETLLNIPIK;DYELQLASYTSGLETLLNIPIKR;ENAAYFQFFEEAQSTEAYLK;IGLVRPGTALELLEAQAATGFIVDPVSNLR;FLEFQYLTGGLVDPEVHGR;GFFDPNTEENLTYLQLK;GY 1.26E-02 (IGLVRPGTALELLEAQAATGFIVDPVSNLR;SAIYQLEEEYENLLK;YCYLQNEVFGLFQK;ALLQAILQTEDMLK;LLEAQIASGGVVDPVNSVFLPK;AVTGYNDPETGNIISLFQAMNK;IEVLEEELR;LLEAQACTGGIIHPTTGQK;FLEFQYLTGGLVDPEVHGR) - 8.11E-03 (ENAAYFQFFEEAQSTEAYLK;GFFDPNTEENLTYLQLK;SVQNDSQAIAEVLNQLK;MTLKNLPLADQGSSHHITVK;NKYETEINITK) 1.57E-02 (AITGFDDPFSGK;AVTGYNDPETGNIISLFQAMNK;ENAAYFQFFEEAQSTEAYLK;GYFNEELSEILSDPSDDTK;IEVLEEELR;LLEAQIASGGVVDPVNSVFLPK;ITNLTQQLEQASIVK;EISMQKEDDSK;TLELQGLINDLQR) 8.88E-02 (AQQIHSQTSQQYPLYDLDLGK;ENAAYFQFFEEAQSTEAYLK;GFFDPNTEENLTYLQLK;SAIYQLEEEYENLLK;TIADLELHYQEFIR;FLEFQYLTGGLVDPEVHGR;GYFNEELSEILSDPSDDTK;LLEAQIASGGVVDPVNSVFLPK;SVQNDSQAIAEVLNQLK;TGSQYDIQDAIDK;ITN 1 IPI00013933.2
737 IPI00013949.1 Small glutamine-rich tetratricopeptide repeat-containing protein A Cyto(G1,GO) - 2.50E-01 (LAYAIIQFLHDQLR;MGLALSSLNK;VENFEAAVHFYGK;LGNYAGAVQDCER) - - - - 1 IPI00013949.1
738 IPI00013957.1 Mitochondrial carnitine/acylcarnitine carrier protein Mito(SP,GO,MitoP2,HPA); Cyto(HPA) 2.81E+00 (AFPANAACFLGFEVAMK;DEGVTSLYK;EGITGLYR;ELIRDEGVTSLYK;FLNWATPNL;GFNAVMIR;NLLAGGFGGVCLVFVGHPLDTVK;CLLQIQASSGESK;KLYQEFGIR;LYQEFGIR) - 5.20E+00 (CLLQIQASSGESK;FLNWATPNL;KLYQEFGIR;LYQEFGIR;NLLAGGFGGVCLVFVGHPLDTVK;AFPANAACFLGFEVAMK;DEGVTSLYK;DVPASGMYFMTYEWLK;EGITGLYR;ELIRDEGVTSLYK;FQTAPPGKYPNGFR;GFNAVMIR) 3.97E-01 (DVPASGMYFMTYEWLK;ELIRDEGVTSLYK;GTVLTLMR;HPEDVLSYPQLFAAGMLSGVFTTGIMTPGER;EGITGLYR;KLYQEFGIR) 7.03E-01 (ELIRDEGVTSLYK;GFNAVMIR;HPEDVLSYPQLFAAGMLSGVFTTGIMTPGER;EGITGLYR;GTVLTLMR;KLYQEFGIR;LYQEFGIR;DVPASGMYFMTYEWLK) 2.53E-01 (CLLQIQASSGESK;ELIRDEGVTSLYK;FQTAPPGKYPNGFR;KLYQEFGIR) 1 IPI00013957.1
739 IPI00013978.1 Speckle-type POZ protein Nucl(SP) - 3.56E-02 (EEMGEVIKSSTFSSGANDKLK;DFLLDEANGLLPDDK) - - - - 1 IPI00013978.1
740 IPI00013981.3 Proto-oncogene tyrosine-protein kinase Yes Cyto(SP,GO,HPA); PM(GO,HPA) - - - - 6.34E-02 (LVPLYAVVSEEPIYIVTEFMSK;LIEDNEYTAR) - 2 IPI00477734.1, IPI00013981.3
741 IPI00013988.1 Rho-GTPase-activating protein 5 Cyto(SP,GO) - 6.40E-03 (VMGNGGLQNTNINLKPCLVK;YRLDLEGNEYPIHSTPNCHDHER) - - - - 1 IPI00013988.1
742 IPI00014053.3 Isoform 1 of Probable mitochondrial import receptor subunit TOM40 homolog Mito(G1,SP,GO,MitoP2) 3.64E-01 (FVNWQVDGEYR;LPPLPLTLALGAFLNHR;GSVDSNWIVGATLEK) - 2.06E-01 (LPPLPLTLALGAFLNHR;KLPPLPLTLALGAFLNHR) 6.27E-02 (LPPLPLTLALGAFLNHR;KLPPLPLTLALGAFLNHR) 3.03E-01 (LPPLPLTLALGAFLNHR;MQDTSVSFGYQLDLPK;QLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLR;KLPPLPLTLALGAFLNHR;MAIQTQQSKFVNWQVDGEYR;GSVDSNWIVGATLEK;RPGEEGTVMSLAGK) - 1 IPI00014053.3
743 IPI00014149.3 Tetratricopeptide repeat protein KIAA0103 Cyto(G2); ER(GO) - - - 1.06E-01 (ALFGLYMSASHIASNPK;YTQGGLENLELSR;NSEQIVEVGEELINEYASK;ILQEDPTNTAAR) 6.81E-02 (ALFGLYMSASHIASNPK;YTQGGLENLELSR;YDDAIQLYDR) - 1 IPI00014149.3
744 IPI00014151.3 26S proteasome non-ATPase regulatory subunit 6 Cyto(G1); Nucl(G1) - 2.53E-01 (GAEILEVLHSLPAVR;SLDWQIDVDLLNK;VYQGLYCVAIR;TYDKTVALGHRLDIVFYLLR;FLLSLPEHR;LDEELEDAEK;RLDEELEDAEK;IDKVNEIVETNRPDSK;IHAYSQLLESYR;YSVFFQSLAVVEQEMK) - 2.56E-02 (IHAYSQLLESYR;FLLSLPEHR) - 9.77E-02 (GAEILEVLHSLPAVR;IHAYSQLLESYR) 1 IPI00014151.3
745 IPI00014186.3 Isoform A of Alpha-fetoprotein enhancer-binding protein Nucl(SP,GO) - - - - - 9.37E-03 (YQLVAHIKEGGK;DSAEGGEGNTGPKETLPDALK;EPLVSFLEPKNK) 1 IPI00014186.3
746 IPI00014198.2 Exosome complex exonuclease RRP42 Nucl(SP); Cyto(GO) - - - - - 1.05E-01 (VYIVHGVQEDLR;GGDDLGTEIANTLYR;HVVDATLQEEACSLASLLVSVTSK) 1 IPI00014198.2
747 IPI00014199.1 Centaurin-beta 1 Cyto(G2) - 1.21E-02 (GPGQGSGHLAIGSAATLGSGGMARGR;EGPGGLVMEGHLFKR) - - - - 1 IPI00014199.1
748 IPI00014220.2 Isoform 1 of Protein KIAA0841 Cyto(G2,SP) - 1.29E-02 (AQFLQNLLLPQAK;AKVDVTFGSLTSAALGLEPVVLR) - - - - 4 IPI00014220.2, IPI00440233.1, IPI00736275.2, IPI00739943.1
749 IPI00014230.1 Complement component 1 Q subcomponent-binding protein, mitochondrial precursor Mito(SP,MitoP2); Nucl(SP); PM(GO) 3.05E-01 (AFVDFLSDEIKEER;VEEQEPELTSTPNFVVEVIK) 2.05E-01 (AFVDFLSDEIKEER;VEEQEPELTSTPNFVVEVIK;ALVLDCHYPEDEVGQEDEAESDIFSIR;GVDNTFADELVELSTALEHQEYITFLEDLK;EVSFQSTGESEWK) 1.55E+00 (AFVDFLSDEIK;AFVDFLSDEIKEER;VEEQEPELTSTPNFVVEVIK;ALVLDCHYPEDEVGQEDEAESDIFSIR;EVSFQSTGESEWK;GVDNTFADELVELSTALEHQEYITFLEDLK) 5.25E-02 (VEEQEPELTSTPNFVVEVIK;AFVDFLSDEIKEER) - 6.35E-01 (AFVDFLSDEIKEER;VEEQEPELTSTPNFVVEVIK;GVDNTFADELVELSTALEHQEYITFLEDLK;ALVLDCHYPEDEVGQEDEAESDIFSIR) 1 IPI00014230.1
750 IPI00014235.2 Similar to RAB3 GTPase-activating protein Cyto(SP,GO,HPA); Nucl(GO,HPA) - 1.12E-01 (KLEEIIHQITNVEALIAR;VLHYLAIQKPADLAR;EMANLR;MQSACLLSDMESFK) - - - - 1 IPI00014235.2
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home