Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
751 IPI00014236.5 KIAA0062 protein Nucl(G1); ER(GO,HPA); PM(GO,HPA) 1.51E-01 (ALLNHLDVGVGR;IGSSELQEFCPTILQQLDSR;YGEGDSLTLQQLK) - - - 1.96E-01 (YGEGDSLTLQQLK;ALLNHLDVGVGR) 2.71E-01 (ALLNHLDVGVGR;IGSSELQEFCPTILQQLDSR;YGEGDSLTLQQLK) 3 IPI00014236.5, IPI00303452.4, IPI00479918.2
752 IPI00014263.1 eukaryotic translation initiation factor 4H isoform 1 Nucl(G2); Cyto(GO) - 3.69E-02 (EALTYDGALLGDR;GFCYVEFDEVDSLK) - - - - 3 IPI00014263.1, IPI00220894.3, IPI00375127.3
753 IPI00014264.5 Centaurin-beta 2 Cyto(G2) - 1.95E-02 (FSDSLQEMINFHTILFDQTQR;GANQHATDEEGKDPLSIAVEAANADIVTLLR;ESEGLYGQPGDETYQDIFR) - - - - 1 IPI00014264.5
754 IPI00014298.3 Periodic tryptophan protein 1 homolog Nucl(SP) - - - - - 4.50E-02 (SDKPIFTLNAHNDEISGLDLSSQIK;KSSSAEGHTDAVLDLSWNK) 1 IPI00014298.3
755 IPI00014310.3 Cullin-1 Cyto(G2,GO); Nucl(GO) - 2.87E-02 (HLEIFHTEFQNLLDADKNEDLGR;HQQLLGEVLTQLSSR;NPEEAELEDTLNQVMVVFK;LISGVVQSYVELGLNEDDAFAK;YIEDKDVFQK;VNINVPMK) - - - - 1 IPI00014310.3
756 IPI00014311.4 Cullin-2 Cyto(G2) - 6.71E-02 (FVQLINTVLNGDQHFMSALDK;FYQEIFESPFLTETGEYYK;VIHGVINSFVHVEQYK;YIDDKDVFQK;HNALIQEVISQSR;KLMVEPLQAILIR;LMVEPLQAILIR;ATSNLTQENMPTLFVESVLEVHGK;IFLENHVR;FSDIYALCVAYPEPLGER) - - - - 1 IPI00014311.4
757 IPI00014312.1 Isoform 1 of Cullin-3 Nucl(SP) - 4.18E-02 (ALVSEEGEGKNPVDYIQGLLDLK;EDGSEVGVGGAQVTGSNTR;GLTEQEVETILDK;TIVEMENSGLVHMLK;SPEYLSLFIDDK;HAFEIFR;IEGLIER;QTIAGDFEYFLNLNSR) - - - - 3 IPI00014312.1, IPI00382458.1, IPI00382459.1
758 IPI00014361.1 GDP-L-fucose synthetase Cyto(G1,GO) - 2.34E-01 (ETCAWFTDNYEQAR;NVHMNDNVLHSAFEVGAR;VQPTHVIHLAAMVGGLFR;VVADGAGLPGEDWVFVSSK;AYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHK;EYNEVEPIILSVGEEDEVSIK;SSGSALTVWGTGNPR;TTYPIDETMIHNGPPHNSNFGYSYAK) - - - - 1 IPI00014361.1
759 IPI00014363.1 betaine-homocysteine methyltransferase 2 Cyto(G1) 4.55E-02 (AIAEELAPER;EGFVDLPEYPFGLESR) 1.38E+00 (AIAEELAPER;GFLPPASEK;YIGGCCGFEPYHIR;AGLWTPEAVIEHPDAVR;AHLMVQPLGFHAPDCGK;EGFVDLPEYPFGLESR;GDALVAGGICQTSIYK;WEDVNAAACDLAR;LESGEVVIGDGSFLITLEK;PFCPSLSKPDF;REYWENLLPASGR;EGLEWAGLK;EYWENLLPASGRPF - - 1.20E-01 (AIAEELAPER;EGFVDLPEYPFGLESR) - 1 IPI00014363.1
760 IPI00014375.1 Glutamyl aminopeptidase PM(G1,GO) 1.70E-01 (ANPSQPPSDLGYTWNIPVK;ASLIDDAFALAR;PLTIYVQPEQK;TQDVFTVIR;TSDFWAALEEASR;VNYEVATWDSIATALSLNHK;SSVLGFACK;LLYGLASVK) - - 2.19E-02 (TSDFWAALEEASR;PIADSLGWNDAGDHVTKLLR;YLDLLK) 5.49E-02 (ISNSGKPLTIYVQPEQK;PLTIYVQPEQK;YLDLLK;EYGALSNMPVAK;TQDVFTVIR;ASLIDDAFALAR) - 1 IPI00014375.1
761 IPI00014376.5 RAB31, member RAS oncogene family variant Cyto(G2) - - - - 1.23E-01 (GSAAAVIVYDITK;NAINIEELFQGISR) - 2 IPI00014376.5, IPI00646692.1
762 IPI00014377.2 Ras-related protein Rab-32 Mito(SP,MitoP2) - 8.19E-02 (DSSQSPSQVDQFCK;ILVNHQSFPNEENDVDKIK;YVHQLFSQHYR) - 2.29E-01 (AGGGAGDPGLGAAAAPAPETR;EAVGAFVVFDISR;VLVIGELGVGK;VHLPNGSPIPAVLLANK;ILVNHQSFPNEENDVDKIK;LQLWDIAGQER) 1.74E-01 (AGGGAGDPGLGAAAAPAPETR;ILVNHQSFPNEENDVDKIK;EHGFAGWFETSAK;VHLPNGSPIPAVLLANK;EAVGAFVVFDISR;DNINIEEAAR;YVHQLFSQHYR) - 1 IPI00014377.2
763 IPI00014439.4 Dihydropteridine reductase Cyto(G1,GO); Mito(MitoP2) - 2.90E+00 (EGGLLTLAGAK;GAVHQLCQSLAGK;MTDSFTEQADQVTAEVGK;NRPSSGSLIQVVTTEGR;QSIWTSTISSHLATK;VDAILCVAGGWAGGNAK;NWWVASVDVVENEEASASIIVK;TELTPAYF;AALDGTPGMIGYGMAK) 1.92E+00 (EGGLLTLAGAK;GAVHQLCQSLAGK;NRPSSGSLIQVVTTEGR;QSIWTSTISSHLATK;VDAILCVAGGWAGGNAK;TELTPAYF) 1.28E-01 (MTDSFTEQADQVTAEVGK;NRPSSGSLIQVVTTEGR;NWWVASVDVVENEEASASIIVK;NSGMPPGAAAIAVLPVTLDTPMNR) 3.02E-01 (MTDSFTEQADQVTAEVGK;NRPSSGSLIQVVTTEGR;EGGLLTLAGAK) 4.56E-01 (GAVHQLCQSLAGK;NRPSSGSLIQVVTTEGR;EGGLLTLAGAK) 1 IPI00014439.4
764 IPI00014474.1 A-kinase anchor protein 8 Nucl(SP,GO,HPA) - - - - - 2.84E-02 (ETPEEVAADVLAEVITAAVR;TVEFLQEYIVNR) 1 IPI00014474.1
765 IPI00014516.1 Isoform 1 of Caldesmon Nucl(G1); Cyto(GO,HPA); PM(GO,HPA) - - - - - 1.46E-02 (LEQYTSAIEGTK;GNVFSSPTAAGTPNK) 5 IPI00014516.1, IPI00218694.1, IPI00218695.1, IPI00218696.1, IPI00333771.1
766 IPI00014533.1 Isoform UBF1 of Nucleolar transcription factor 1 Nucl(G1,GO,HPA) - - - - - 4.95E-02 (FSQELLSNGELNHLPLK;FREDHPDLIQNAK;TLTELILDAQEHVK) 2 IPI00014533.1, IPI00220833.1
767 IPI00014577.1 Ras-related protein Rab-18 ER(G1) 2.48E-01 (ILIIGESGVGK;TCDGVQCAFEELVEK;LAIWDTAGQER) 1.94E-01 (FTDDTFDPELAATIGVDFK;ILIIGESGVGK) - 7.48E-01 (FTDDTFDPELAATIGVDFK;HSMLFIEASAK;IIQTPGLWESENQNK;ILIIGESGVGK;KHSMLFIEASAK;NDIVNMLVGNK;TLTPSYYR;LAIWDTAGQER) 1.58E+00 (FTDDTFDPELAATIGVDFK;IIQTPGLWESENQNK;ILIIGESGVGK;NDIVNMLVGNK;HSMLFIEASAK;LAIWDTAGQER) 2.22E-01 (FTDDTFDPELAATIGVDFK;IIQTPGLWESENQNK) 1 IPI00014577.1
768 IPI00014589.1 Isoform Brain of Clathrin light chain B Cyto(G2,SP) - 4.59E-02 (VAQLCDFNPK;QSEQVEKNKINNR) - - - - 2 IPI00014589.1, IPI00216472.1
769 IPI00014603.1 Ras-related protein Rab-9B Cyto(G2) - - - - 3.91E-02 (VILLGDGGVGK;FVTLQIWDTAGQER) - 1 IPI00014603.1
770 IPI00014624.2 Adapter-related protein complex 3 sigma 1 subunit Cyto(G2,SP) - - - 4.52E-02 (FYQPYSEDTQQQIIR;NMNLPEIPRNINIGDISIK) - - 1 IPI00014624.2
771 IPI00014808.1 Platelet-activating factor acetylhydrolase IB subunit gamma Cyto(SP) - 1.67E-01 (AHFLDADPGFVHSDGTISHHDMYDYLHLSR;LENGELEHIRPK;VVVLGLLPR;ELFSPLHALNFGIGGDGTQHVLWR) - - - - 1 IPI00014808.1
772 IPI00014829.2 Cadherin protein PM(G2) - - - - 7.35E-03 (DEEAAEKKFEASR;FQPLASVFNDIAK) 8.71E-03 (DGHFEIDSSTGDLFLSKELDYETTSHYLFRVITTDHSK;FQPLASVFNDIAK) 1 IPI00014829.2
773 IPI00014832.3 [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial precursor Mito(SP,GO,MitoP2,HPA); Cyto(GO,HPA); Nucl(GO,HPA) - - 5.84E-02 (DTYGDDPVSNQNIQYFLDR;ATVESHESSLILPPIK;TLSQFTDALVTIR) - - - 1 IPI00014832.3
774 IPI00014852.1 Phosphoglucomutase-like protein 5 Cyto(G2,SP) - 1.74E-02 (VEIVDPVDIYLNLLR;FNVANGGPAPDVVSDK) - - - - 2 IPI00014852.1, IPI00555832.3
775 IPI00014873.2 Isoform 1 of Cell division protein kinase 10 Cyto(G2) 5.97E-02 (FPWLSEAGLR;ATAGDCLESSYFK) - - - - - 6 IPI00014873.2, IPI00374326.1, IPI00639889.2, IPI00640403.1, IPI00646393.1, IPI00788960.1
776 IPI00014877.4 glutaminyl-peptide cyclotransferase-like Cyto(G2) - - - 5.83E-02 (VPLIGSLPEAR;HLAQLMESIPHSPGPTR) - - 2 IPI00014877.4, IPI00061796.3
777 IPI00014898.1 Isoform 1 of Plectin-1 Nucl(G1); PM(GO,HPA); Cyto(SP,GO,HPA) - - - 4.07E-03 (GRLPLLAVCDYK;NDDIADGNPK;EQMAQQLAEETQGFQR;LLEAQIATGGIIDPVNSHRVPVDVAYQR) - 1.22E-02 (AGVVGPELHEQLLSAEK;AKLEQLFQDEVAK;AQVEQELTTLR;AYSDPSTGEPATYGELQQR;DLLPSDMAVALLEAQAGTGHIIDPATSAR;DTHDQLSEPSEVR;ENAAYFQFFSDVR;FLEGTSCIAGVFVDATK;GFFDPNTEENLTYLQLMER;GFFDPNTHENLTYR;GIYQSLEGAVQAGQL 3 IPI00215943.1, IPI00215942.1, IPI00014898.1
778 IPI00014919.1 UTP--glucose-1-phosphate uridylyltransferase 1 Nucl(G1) - - - - - 4.60E-01 (GTVIIIANHGDRIDIPPGAVLENK;IFNTNNLWISLAAVK;IQRPPEDSIQPYEK;SFENSLGINVPR;TLDGGLNVIQLETAVGAAIK;EFPTVPLVK;GLPDNISSVLNK;IDIPPGAVLENK;LVEIAQVPK;NENTFLDLTVQQIEHLNK;GTVIIIANHGDR;ELEKILTTATSHEYEHTK) 1 IPI00014919.1
779 IPI00014952.1 CDNA FLJ20142 fis, clone COL07365 Nucl(G2) - - 2.50E-02 (FLEIHGETIEK;FLEIHGETIEKVVFAVSDLEEGTYQKLLPLYFPR) - - - 2 IPI00014952.1, IPI00643598.1
780 IPI00014978.3 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform Cyto(SP,GO); Nucl(SP) - 1.91E-02 (GVIVESAYSDIVK;DTTLTEPVIR) - - - - 1 IPI00014978.3
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home