Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
781 IPI00015018.1 Inorganic pyrophosphatase Cyto(G1,GO) - 7.02E-01 (DKDFAIDIIK;VPDGKPENEFAFNAEFK;LKPGYLEATVDWFR;YKVPDGKPENEFAFNAEFK;DPLNPIKQDVK;GQYISPFHDIPIYADK;GQYISPFHDIPIYADKDVFHMVVEVPR;GYIWNYGAIPQTWEDPGHNDK;HTGCCGDNDPIDVCEIGSK;VIAINVDDPDAANYNDINDVK;VIAIN - - - - 1 IPI00015018.1
782 IPI00015102.2 Isoform 1 of CD166 antigen precursor PM(G1) 6.09E-01 (FVCMLVTEDNVFEAPTIVK;QIGDALPVSCTISASR;SSPSFSSLHYQDAGNYVCETALQEVEGLK;SVQYDDVPEYK;TIHSEQAVFDIYYPTEQVTIQVLPPK;TIICHVEGFPK;VLHPLEGAVVIIFK;YEKPDGSPVFIAFR;ALFLETEQLK;SSNTYTLTDVR) - - - 6.36E-02 (EMDPVTQLYTMTSTLEYK;ESLTLIVEGKPQIK;YEKPDGSPVFIAFR;VLHPLEGAVVIIFK) 1.06E-01 (VLHPLEGAVVIIFK;YEKPDGSPVFIAFR;QIGDALPVSCTISASR;SSPSFSSLHYQDAGNYVCETALQEVEGLK;TIICHVEGFPK;ESLTLIVEGKPQIK) 4 IPI00015102.2, IPI00783803.2, IPI00795504.1, IPI00807403.1
783 IPI00015117.2 Isoform Long of Laminin gamma-2 chain precursor PM(G2) 1.82E-02 (LSRAKTQINSQLR;LLDSKCDCDPAGIAGPCDAGRCVCK) - - - - - 1 IPI00015117.2
784 IPI00015140.1 Cytochrome b Mito(G1,GO,MitoP2) - - 5.46E-01 (ITFHPYYTIK;DVNYGWIIR) - - - 3 IPI00015140.1, IPI00386820.2, IPI00741999.3
785 IPI00015148.3 Ras-related protein Rap-1b precursor Cyto(G1,SP); PM(SP,GO) - 1.40E+00 (INVNEIFYDLVR;LVVLGSGGVGK;SALTVQFVQGIFVEK;YDPTIEDSYR;YDPTIEDSYRK;NGQGFALVYSITAQSTFNDLQDLR;VKDTDDVPMILVGNK;QINRKTPVPGK) - 1.93E+00 (DTDDVPMILVGNK;LVVLGSGGVGK;SALTVQFVQGIFVEK;VKDTDDVPMILVGNK;YDPTIEDSYR;YDPTIEDSYRK;INVNEIFYDLVR;SKINVNEIFYDLVR) 3.14E+00 (DTDDVPMILVGNK;LVVLGSGGVGK;SALTVQFVQGIFVEK;VKDTDDVPMILVGNK;YDPTIEDSYR;YDPTIEDSYRK;NGQGFALVYSITAQSTFNDLQDLR;MREYKLVVLGSGGVGK;INVNEIFYDLVR) - 1 IPI00015148.3
786 IPI00015149.1 Isoform 1 of Autoimmune regulator Nucl(G2,SP,HPA); PM(HPA); Cyto(SP,HPA) - 1.68E-02 (AVAMSSGDVPGARGAVEGILIQQVFESGGSK;NKARSSSGPK) - - - - 1 IPI00015149.1
787 IPI00015175.1 Protein Wnt-2 precursor Cyto(G2,GO); PM(GO) - 2.02E-02 (ACSQGEVKSCSCDPKK;FARAFVDAKER) - - - - 2 IPI00015175.1, IPI00657998.1
788 IPI00015195.1 Cleavage stimulation factor 77 kDa subunit Nucl(SP,GO) - - - - - 9.98E-02 (KYGDIPEYVLAYIDYLSHLNEDNNTR;LAAIIPDPVVAPSIVPVLK;FLAFESNIGDLASILK) 1 IPI00015195.1
789 IPI00015262.9 Calponin-2 Cyto(G2) - 6.12E-02 (GPSYGLSAEVK;LQPGSVPK) - - - - 2 IPI00398735.3, IPI00015262.9
790 IPI00015285.7 Ethanolamine-phosphate cytidylyltransferase Cyto(G1) - 7.40E-01 (GPPVFTQEER;TEIIPDRDGSDPYQEPK;WVDEVVPAAPYVTTLETLDK;WVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGR;YNCDFCVHGNDITLTVDGR;AMGDYLIVGVHTDEEIAK;LAERPYIIAGLHFDQEVNHYK;NPWTGVSQFLQTSQK;QIDSGSNLTTDLIVQR;TQGVST - - - - 1 IPI00015285.7
791 IPI00015309.1 Keratin, type I cytoskeletal 12 Nucl(G2) 2.16E-02 (LASYLDKVR;SGELRKEISTNTEQLQSSK) 1.10E-02 (LASYLDKVR;DAEAWFIEK;TDLEMQIESLNEELAYMK) - 1.30E-02 (LASYLDKVR;LELEIETYR) 1.39E-02 (LASYLDKVR;LELEIETYR) - 1 IPI00015309.1
792 IPI00015346.1 Cadherin EGF LAG seven-pass G-type receptor 2 precursor PM(SP) 1.03E-02 (EDVTPGAPVLR;QRRHPELSQGEAVASVIIYR) - - - - - 1 IPI00015346.1
793 IPI00015351.1 AD039 Cyto(G1) - 1.23E-01 (FVESDADEELLFNIPFTGNVK;RHEVTICNYEASANPADHR;VHQVTPQTHFIS;GVFKPWEER;FSNVYHLSIHISK) - - - - 1 IPI00015351.1
794 IPI00015361.1 Prefoldin subunit 5 Cyto(G1,GO); Nucl(GO) - 2.38E-01 (IQQLTALGAAQATAK;LHDVEHVLIDVGTGYYVEK;TAEDAKDFFK;NQLDQEVEFLSTSIAQLK) - - - - 1 IPI00015361.1
795 IPI00015388.1 Platelet-activating factor acetylhydrolase 2, cytoplasmic Cyto(SP) 1.28E-01 (DSGYPLIIFSHGLGAFR;GFVVAVPEHR;GPVFFINTEK) - - - - - 1 IPI00015388.1
796 IPI00015473.3 Excitatory amino acid transporter 1 Nucl(G1); Mito(MitoP2); PM(GO) - - - - - 4.34E-02 (TTTNVLGDSLGAGIVEHLSR;AVVYYMTTTIIAVVIGIIIVIIIHPGK) 2 IPI00015473.3, IPI00642894.1
797 IPI00015526.3 Isoform 1 of Histone-lysine N-methyltransferase, H3 lysine-9 specific 5 Nucl(G1,SP,GO) - - - - - 2.84E-02 (PTPGLSQGPGKETLESALIALDSEK;ETLESALIALDSEK;NKEGETPLQCASLNSQVWSALQMSK) 2 IPI00015526.3, IPI00216443.4
798 IPI00015560.7 Isoform 1 of Stat3-interacting protein Cyto(SP,GO,HPA); Nucl(SP,GO) - 3.78E-02 (AVHLQGHEGPVYAVHAVYQR;STSLETQDDDNIR;NFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNK;TSDPALCTLIVSAAADSAVR) - - - - 5 IPI00015560.7, IPI00289763.2, IPI00296893.4, IPI00304246.2, IPI00470701.2
799 IPI00015595.4 Isoform 1 of Coiled-coil domain-containing protein 102B Nucl(G1) - - - - - 2.47E-02 (QSLPPQKEALEANVTQDLK;QGLERENR) 3 IPI00015595.4, IPI00385048.2, IPI00479238.4
800 IPI00015602.1 Mitochondrial precursor proteins import receptor Mito(G1,GO,MitoP2,HPA) 1.45E-01 (ILLDQVEEAVADFDECIR;LRPESALAQAQK;DKEGEALEVKENSGYLK) - 2.73E-01 (ILLDQVEEAVADFDECIR;LRPESALAQAQK;ATFYLLIGNANAAKPDLDK) - - - 1 IPI00015602.1
801 IPI00015695.2 hypothetical protein LOC79864 isoform 1 Cyto(G2) - 1.13E-02 (EMENAAIDPEDK;EYNMKTLSILSK) - - - - 1 IPI00015695.2
802 IPI00015736.3 Ubiquitin-activating enzyme E1 domain-containing protein 1 Cyto(SP,GO,HPA); Nucl(SP) - 7.17E-02 (NFSGPVPDLPEGITVAYTIPK;ISNGGLEEGKPVDLVLSCVDNFEAR;LFFQPHQAGLSK) - - - - 2 IPI00015736.3, IPI00383579.2
803 IPI00015773.3 COMM domain-containing protein 3 Cyto(G1) - 1.38E-01 (NSLEILLGSIGR;SFDSNAFTLLLR;AAFQSLLDAQADEAVLDHPDLK) - 9.72E-02 (SFDSNAFTLLLR;NSLEILLGSIGR) 1.04E-01 (AAFQSLLDAQADEAVLDHPDLK;SFDSNAFTLLLR) - 1 IPI00015773.3
804 IPI00015799.2 Diacylglycerol O-acyltransferase 1 ER(G1,GO) - - - 1.79E-01 (DAAAGPDVGAAGDAPAPAPNK;LQDSLFSSDSGFSNYR;YGILVDPIQVVSLFLK) 8.52E-02 (DAAAGPDVGAAGDAPAPAPNK;LQDSLFSSDSGFSNYR) - 2 IPI00015799.2, IPI00735599.1
805 IPI00015805.2 Ras-interacting protein 1 Cyto(G2,SP) - - - - 1.78E-02 (GSGTGTTGSSGAGGPGTPGGAQR;RLEQEAFGAADSEGTGAPSWRPQK) - 1 IPI00015805.2
806 IPI00015806.3 Isoform 1 of General transcription factor 3C polypeptide 3 Nucl(SP,GO) - - - - - 7.53E-02 (SYYEANDVTSAINIIDEAFSK;ALEIITDFSGIVLEK;ISLSTLQQQLGQPEK) 1 IPI00015806.3
807 IPI00015809.1 Probable O-sialoglycoprotein endopeptidase Cyto(G2) - 6.25E-02 (TYVTPPGTGFLPGDTAR;YRTDEVEVTWRD) - - - - 1 IPI00015809.1
808 IPI00015826.1 ATP-binding cassette sub-family B member 10, mitochondrial precursor Mito(SP,GO,MitoP2) - - 8.20E-02 (LRPAAAGLPEAR;SVTENLSDGLR;LSSDTALLGR;TSLFSSILR) - - - 1 IPI00015826.1
809 IPI00015833.1 Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 Mito(G1,MitoP2,HPA) 2.98E-01 (RVTFEADENENITVVK;VAEELALEQAK;YSGAYGASVSDEELK) - 6.24E-01 (VAEELALEQAK;YSGAYGASVSDEELK) 1.08E-01 (VAEELALEQAK;YSGAYGASVSDEELK) 2.90E-01 (VAEELALEQAK;YSGAYGASVSDEELK;YSGAYGASVSDEELKR) 9.17E-02 (VAEELALEQAK;YSGAYGASVSDEELK) 1 IPI00015833.1
810 IPI00015836.1 DCC-interacting protein 13 alpha Cyto(G1,GO); Nucl(SP,GO) - 1.04E-01 (EVFQIASNDHDAAINR;IYDAQNELSAATHLTSK;LLKEYEKQR;IALLEPLLGYMQAQISFFK;SETEDSILHQLFIVR;SESNLSSVCYIFESNNEGEK;VNQSALEAVTPSPSFQQR;LIDPQTQVTR) - - - - 1 IPI00015836.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home