Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
811 IPI00015839.1 Ras-related protein Rab-20 Cyto(G2) - - - 8.10E-02 (VSPRAPKQVQLEDAVALYK;APKQVQLEDAVALYK) 8.70E-02 (VSPRAPKQVQLEDAVALYK;GAAAIILTYDVNHR;IVLLGDMNVGK) - 1 IPI00015839.1
812 IPI00015842.1 Reticulocalbin-1 precursor ER(SP,HPA) 1.61E-01 (AADLNGDLTATR;EIVVLETLEDIDK;TFDQLTPDESKER;TFDQLTPDESK) - - 1.96E+00 (AADLNGDLTATR;EEFTAFLHPEEFEHMK;EIVVLETLEDIDK;HWILPQDYDHAQAEAR;IDNDGDGFVTTEELK;IVDRIDNDGDGFVTTEELK;LTKEEILENWNMFVGSQATNYGEDLTK;QATYGYYLGNPAEFHDSSDHHTFK;TFDQLTPDESK;TFDQLTPDESKER;YIFDNVAK) 1.94E+00 (AADLNGDLTATR;EEFTAFLHPEEFEHMK;EEILENWNMFVGSQATNYGEDLTK;EIVVLETLEDIDK;HWILPQDYDHAQAEAR;IDNDGDGFVTTEELK;IVDRIDNDGDGFVTTEELK;LTKEEILENWNMFVGSQATNYGEDLTK;NGDGFVDQDEYIADMFSHEENGPEPDWVLSER;TFDQLTP 7.42E-02 (TFDQLTPDESK;IDNDGDGFVTTEELK) 1 IPI00015842.1
813 IPI00015856.4 Hypothetical protein DNPEP Cyto(SP) - 4.52E-01 (GFFELFPSLSHNLLVD;IPHLAIHLQR;ISASCQHPTAFEEAIPK;LDNLHSCFCALQALIDSCAGPGSLATEPHVR;LEQQLVHVERPILR;LLQAGFSELK;LLQAGFSELKETEK;MVTLYDNEEVGSESAQGAQSLLTELVLR;NDTPCGTTIGPILASR;NSSTIIAFAVGGQYVPGNGFSLIGA - - - - 2 IPI00015856.4, IPI00658215.1
814 IPI00015865.6 ADP-ribosylhydrolase like 2 variant Nucl(SP,GO,HPA) - 8.82E-02 (IGELLDQASVTR;HVQSLEPDPGTPGSER) - - - - 1 IPI00015865.6
815 IPI00015897.2 Cysteine and histidine-rich domain (CHORD)-containing 1 Cyto(G2) - 4.37E-02 (FQEHIIQAPKPVEAIK;TSDFNTFLAQEGCTK;EFDQNVKLWGVIDVK;RPSPDEPMTNLELK) - - - - 1 IPI00015897.2
816 IPI00015902.3 Beta platelet-derived growth factor receptor precursor PM(G2,GO) - 1.15E-02 (RRPPSAELYSNALPVGLPLPSHVSLTGESDGGYMDMSK;AFHEDAEVQLSFQLQINVPVRVLELSESHPDSGEQTVR) - - - - 1 IPI00015902.3
817 IPI00015905.1 Exosome complex exonuclease RRP4 Cyto(SP,GO); Nucl(SP) - 2.87E-02 (YGKLGQGVLVQVSPSLVK;LGQGVLVQVSPSLVK) - - - 7.73E-02 (LGQGVLVQVSPSLVK;YIGEVGDIVVGR) 2 IPI00015905.1, IPI00647528.1
818 IPI00015911.1 Dihydrolipoyl dehydrogenase, mitochondrial precursor Mito(SP,GO,MitoP2) 1.27E-01 (SEEQLKEEGIEYK;VCHAHPTLSEAFR;NLGLEELGIELDPR) 2.17E-01 (ALTGGIAHLFK;NETLGGTCLNVGCIPSK;NLGLEELGIELDPR;SEEQLKEEGIEYK;VCHAHPTLSEAFR;IDVSIEAASGGK) 3.27E+00 (ALTGGIAHLFK;NETLGGTCLNVGCIPSK;NLGLEELGIELDPR;SEEQLKEEGIEYK;VCHAHPTLSEAFR;VLGAHILGPGAGEMVNEAALALEYGASCEDIAR;IDVSIEAASGGK) 6.39E-02 (IPNIYAIGDVVAGPMLAHK;SEEQLKEEGIEYK) - 1.40E+00 (ALTGGIAHLFK;IDVSIEAASGGK;NETLGGTCLNVGCIPSK;NLGLEELGIELDPR;SEEQLKEEGIEYK;VCHAHPTLSEAFR) 1 IPI00015911.1
819 IPI00015922.2 Isoform 1 of Integrator complex subunit 6 Nucl(SP,GO,HPA); Cyto(HPA) - - - - 1.51E-02 (RPGEPNMQGIPK;EYTGFQVALLNK) - 2 IPI00015922.2, IPI00741295.1
820 IPI00015927.1 Tyrosine-protein kinase 6 Cyto(SP); PM(HPA); Nucl(SP,HPA) - - - - 2.68E-02 (EDVYLSHDHNIPYK;EEQWWWATLLDEAGGAVAQGYVPHNYLAER) - 1 IPI00015927.1
821 IPI00015944.3 Echinoderm microtubule-associated protein-like 2 Cyto(G2) - 7.34E-02 (LQEVEVPEDFGPVR;LKLEWVYGYR;ITQAVLGAHDGGVFGLCALR;SHIYFWTLEGGSLSK;VHLFSYPCCQPR;SAGFHPSGSVLAVGTVTGR) - - - - 1 IPI00015944.3
822 IPI00015947.4 DnaJ homolog subfamily B member 1 Cyto(G2,SP); Nucl(SP) - 2.18E-02 (EGDQTSNNIPADIVFVLK;DVIRPGMR) - - - - 1 IPI00015947.4
823 IPI00015952.1 Eukaryotic translation initiation factor 4 gamma 2 Nucl(G2) - - 1.14E-02 (FSASSGGGGSRGAPQHYPK;EDITQEFPGK) - - - 2 IPI00015952.1, IPI00782985.1
824 IPI00015953.3 Isoform 1 of Nucleolar RNA helicase 2 Nucl(SP,HPA) - - - - - 6.06E-02 (EGAFSNFPISEETIK;NEEPSEEEIDAPKPK) 2 IPI00015953.3, IPI00477179.1
825 IPI00015954.1 GTP-binding protein SAR1a Cyto(G1); ER(GO,HPA) - 5.02E-01 (LVFLGLDNAGK;TTLLHMLK;NYLPAINGIVFLVDCADHSR;LGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQAR;LREIFGLYGQTTGK;EIFGLYGQTTGK) - 2.85E-01 (EIFGLYGQTTGK;LGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQAR;LVFLGLDNAGK;VELNALMTDETISNVPILILGNK;TTLLHMLK) 3.44E-01 (LVFLGLDNAGK;TTLLHMLK;LGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQAR;EIFGLYGQTTGK;VELNALMTDETISNVPILILGNK) - 1 IPI00015954.1
826 IPI00015973.1 Band 4.1-like protein 2 Cyto(G2); Nucl(HPA); PM(GO,HPA) - 2.46E-02 (QKSYTLVVAKDGGDK;VTLLDGTEYSCDLEK;GLSPAQADSQFLENAK;LGVCANGLLIYK;EISPGSGPGEIR) - - - - 1 IPI00015973.1
827 IPI00015980.3 Isoform 2 of Multiple PDZ domain protein PM(SP) 1.28E-02 (LTIHAENPDSQAVPSAAGAASGEK;NVQGLGITIAGYIGDKK) 8.22E-03 (DQGGLGIAISEEDTLSGVIIK;VGDQILAVDDEIVVGYPIEK;ERGDVANEDKLSLLK) - - - 9.86E-03 (LTIHAENPDSQAVPSAAGAASGEK;IGDTDLAGMSSEQVAQVLR) 3 IPI00015980.3, IPI00552988.4, IPI00553004.2
828 IPI00015995.1 Kelch-like protein 1 Nucl(G2); Cyto(G2,SP,GO) - 1.36E-02 (LLKSQERSGVSTFWK;VEPDNSSQATGEGCGHR) - - - - 1 IPI00015995.1
829 IPI00016007.1 Myosin-5C Cyto(G2) - 4.13E-03 (SGSNAHVEDKVLASNPITEAVGNAK;LEDQNKENHGLVEK) - 5.84E-03 (EMREKMSEITK;VLASNPITEAVGNAK) 6.27E-03 (EMREKMSEITK;MGGNTVIEGVNDRAEMVETQK) - 1 IPI00016007.1
830 IPI00016053.2 hypothetical protein LOC128876 Nucl(G2) - - 1.63E-02 (TAGAGSGDEKRLTLGHSK;LTLGHSKLDLITK) - - - 3 IPI00016053.2, IPI00552930.2, IPI00789922.1
831 IPI00016067.1 Isoform 1 of Matrix metalloproteinase-19 precursor Cyto(G2) - - - 3.04E-02 (CGLEDPFNQKTLK;TLKYLLLGR) - - 4 IPI00016067.1, IPI00218151.1, IPI00791255.1, IPI00792408.1
832 IPI00016074.1 M-phase phosphoprotein 6 Nucl(SP,HPA); Cyto(SP,HPA) - - - - - 7.73E-02 (DHANYEEDENGDITPIK;RYETLVGTIGK) 1 IPI00016074.1
833 IPI00016255.4 hypothetical protein LOC79887 Cyto(G2,SP) - - - 2.86E-02 (LGLDYSYDLAPR;TLHQGMPEVYNFDFITMKPILK) - - 1 IPI00016255.4
834 IPI00016287.5 Threonine synthase-like 1 Mito(G1) - 4.68E-02 (FFSEAVIEGLASDGGLFVPAK;TCPVIISSTAHYSK;SHVEQLVQNQFI;IKEINETSSSQLYLLGSYNALPPLHEALLER;IAVVAFFPENGVSDFQK) 9.81E-01 (EINETSSSQLYLLGSYNALPPLHEALLER;FFSEAVIEGLASDGGLFVPAK;FICASNQNHVLTDFIK;LGCCVIDVDDDILEK;LQDVGNEQFLEEEGK;TCPVIISSTAHYSK;HLSGNQFILELFHGPTGSFK;IAVVAFFPENGVSDFQK;VFCESGASPEEVADK;YQDVDSETFISTR) - - - 1 IPI00016287.5
835 IPI00016339.4 Ras-related protein Rab-5C Cyto(G1) 2.24E-01 (FEIWDTAGQER;LVLLGESAVGK;QASPNIVIALAGNK) 5.03E-01 (FEIWDTAGQER;GAQAAIVVYDITNTDTFAR;LVLLGESAVGK;GVDLQENNPASR) 1.45E-01 (GAQAAIVVYDITNTDTFAR;LVLLGESAVGK;GVDLQENNPASR) 5.99E-01 (AVEFQEAQAYADDNSLLFMETSAK;GAQAAIVVYDITNTDTFAR;LVLLGESAVGK;QASPNIVIALAGNK;YHSLAPMYYR;GVDLQENNPASR;TAMNVNEIFMAIAK) 1.12E+00 (LVLLGESAVGK;YHSLAPMYYR;GAQAAIVVYDITNTDTFAR;QASPNIVIALAGNK;AVEFQEAQAYADDNSLLFMETSAK;GVDLQENNPASR;TAMNVNEIFMAIAK) 4.19E-01 (LVLLGESAVGK;GAQAAIVVYDITNTDTFAR;FEIWDTAGQER;QASPNIVIALAGNK) 1 IPI00016339.4
836 IPI00016342.1 Ras-related protein Rab-7 ER(G1); Cyto(SP) 1.05E+00 (ATIGADFLTK;DEFLIQASPR;DPENFPFVVLGNK;EAINVEQAFQTIAR;FQSLGVAFYR) 1.15E+00 (ATIGADFLTK;VIILGDSGVGK;FSNQYKATIGADFLTK;EAINVEQAFQTIAR;QETEVELYNEFPEPIK;TLDSWRDEFLIQASPR;DEFLIQASPR;DPENFPFVVLGNK;FQSLGVAFYR;GADCCVLVFDVTAPNTFK;NALKQETEVELYNEFPEPIK;NNIPYFETSAK) - 2.04E+00 (ATIGADFLTK;TSLMNQYVNK;VIILGDSGVGK;DPENFPFVVLGNK;EAINVEQAFQTIAR;NALKQETEVELYNEFPEPIK;NNIPYFETSAK;QETEVELYNEFPEPIK;FQSLGVAFYR;LVTMQIWDTAGQER;DEFLIQASPR) 3.05E+00 (ATIGADFLTK;TSLMNQYVNK;VIILGDSGVGK;TSLMNQYVNKK;DEFLIQASPR;DPENFPFVVLGNK;EAINVEQAFQTIAR;FQSLGVAFYR;LVTMQIWDTAGQER;NALKQETEVELYNEFPEPIKLDK;NNIPYFETSAK;QETEVELYNEFPEPIK;TLDSWRDEFLIQASPR) 1.39E+00 (ATIGADFLTK;VIILGDSGVGK;EAINVEQAFQTIAR;QETEVELYNEFPEPIK;DPENFPFVVLGNK;GADCCVLVFDVTAPNTFK;NALKQETEVELYNEFPEPIK;NALKQETEVELYNEFPEPIKLDK;FQSLGVAFYR) 1 IPI00016342.1
837 IPI00016346.1 Proline synthetase co-transcribed bacterial homolog protein Cyto(G1) - 3.29E-01 (HGLPPSETIAIVEHINAK;TKPADMVIEAYGHGQR;TFGENYVQELLEK;IGSTIFGER) - - - - 1 IPI00016346.1
838 IPI00016371.1 Isoform JM-A of Receptor tyrosine-protein kinase erbB-4 precursor Nucl(SP,GO,HPA); Cyto(GO,HPA) - - - 1.14E-02 (KDGNFGLQELGLK;NNILSMPEKAKK) 6.52E-03 (VLGSGAFGTVYK;SVREVTGYVLVALNQFR) - 2 IPI00016371.1, IPI00215722.1
839 IPI00016372.1 Ras-related protein Rab-9A Cyto(G1) - 8.09E-02 (MAGKSSLFK;EFIYYADVKEPESFPFVILGNK;FDTQLFHTIGVEFLNK) - 1.43E-01 (EFIYYADVKEPESFPFVILGNK;DATNVAAAFEEAVR;SDHLIQTDTVNLHR) 1.47E-01 (EFIYYADVKEPESFPFVILGNK;FDTQLFHTIGVEFLNK;SDHLIQTDTVNLHR;VILLGDGGVGK) - 1 IPI00016372.1
840 IPI00016373.3 Ras-related protein Rab-13 PM(SP,GO,HPA); Cyto(SP,GO,HPA) 3.97E-02 (LLIIGDSGVGK;ENASAGVERLLLGNK) - - 4.79E-02 (LLIIGDSGVGK;SSMNVDEAFSSLAR;GAMGIILVYDITDEK) 2.53E-02 (LLIIGDSGVGK;ENASAGVERLLLGNK) - 1 IPI00016373.3
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home