Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
841 IPI00016381.2 Isoform Long of Ras-related protein Rab-27A ER(G1) - - - 3.61E-01 (FLALGDSGVGK;FITTVGIDFR;SLTTAFFR;IHLQLWDTAGQER;TSVLYQYTDGK;VVKEEEAIALAEK) 6.26E-01 (FLALGDSGVGK;IHLQLWDTAGQER;TSVLYQYTDGK;SLTTAFFR;VVKEEEAIALAEK) 1.06E-01 (FLALGDSGVGK;TSVLYQYTDGK;IHLQLWDTAGQER) 1 IPI00016381.2
842 IPI00016405.1 CDNA FLJ20455 fis, clone KAT05813 PM(G1) 1.24E+00 (KLENSPLGEALR;LENSPLGEALR;SVPLAATSMLITQGLISK;VFAECNDESFWFR;ESYEVSLTQK;NITYEELR) - 5.20E-02 (GILSSHPKYGSIPK;LENSPLGEALR) 1.67E-01 (LENSPLGEALR;SVPLAATSMLITQGLISK;KLENSPLGEALR) 3.58E-01 (KLENSPLGEALR;LENSPLGEALR;SVPLAATSMLITQGLISK;NITYEELR) - 1 IPI00016405.1
843 IPI00016447.5 COMM domain-containing protein 8 Nucl(G2) - 7.64E-02 (EELQNLIQSLEAANK;MPLLSLHLDVK) - - - - 1 IPI00016447.5
844 IPI00016457.4 Isoform 1 of Carnitine O-acetyltransferase Mito(G1,MitoP2) - - 3.92E-01 (ALQPIVSEEEWAHTK;QLVDEFQASGGVGER;KTENWLSEWWLK;LPVPPLQQSLDHYLK;LSPDAFIQMALQLAYYR;IYGQACATYESASLR;FNITPEIK) 2.09E-02 (LSPDAFIQMALQLAYYR;LPVPPLQQSLDHYLK) - - 3 IPI00016457.4, IPI00029140.6, IPI00514595.2
845 IPI00016458.2 Isoform 1 of L-2-hydroxyglutarate dehydrogenase, mitochondrial precursor Mito(SP,GO,MitoP2) 6.62E-02 (ILHVRNAPSPAATSSIAISGMIADEVQQR;LQALYEKGLQNGVPGLR;FAGGSPGACGFASGRPR) - 1.12E-01 (LIVAVEQEEIPR;ISELSGCTPDPR;FIPEITISDILR;GNIYPVPDSR;GLQNGVPGLR;DGNLVEDFVFDAGVGDIGNR) - - - 1 IPI00016458.2
846 IPI00016467.1 SLIT and NTRK-like protein 3 precursor PM(G2) - - 1.80E-02 (ENAWPTKPSSMLSSVHFTASSVEYK;HHEKNGGVVLFPPGGGCGSGSMLLDR) - - - 1 IPI00016467.1
847 IPI00016478.1 CDNA FLJ20508 fis, clone KAT09559 Cyto(G2) - 5.29E-02 (QLVAGDIVLDKLGER;FEDVPALR) - - - - 1 IPI00016478.1
848 IPI00016480.3 Isoform 1 of NACHT, LRR and PYD-containing protein 2 Cyto(SP,GO) - - - 1.66E-02 (DLAAVLVVSR;NPQLIIDTEKHHPWAER) - - 3 IPI00016480.3, IPI00218560.1, IPI00719706.1
849 IPI00016513.5 Ras-related protein Rab-10 ER(G1) 2.65E-01 (AFLTLAEDILR;LLIIGDSGVGK;IQIWDTAGQER) 5.13E-02 (AFLTLAEDILR;IQLWDTAGQER) - 2.01E-01 (AFLTLAEDILR;IQIWDTAGQER;LLIIGDSGVGK;TYDLLFK;GAMGIMLVYDITNGK;FHTITTSYYR) 4.20E-01 (AFLTLAEDILR;FSDDAFNTTFISTIGIDFK;IQIWDTAGQER;LLIIGDSGVGK;KTYDLLFK;FHTITTSYYR) 1.24E-01 (AFLTLAEDILR;IQLWDTAGQER) 1 IPI00016513.5
850 IPI00016553.1 Isoform 1 of Solute carrier organic anion transporter family member 2B1 ER(G1); PM(SP,GO) 1.02E-01 (KQDGLVQIAPNLTVIQFIK;QDGLVQIAPNLTVIQFIK;SSPAVEQQLLVSGPGK) - - - 1.82E-01 (SSPAVEQQLLVSGPGK;YDNTSPEDMPQDFK;FIGLQFFFK;ETKATMGTENTPGGK) - 1 IPI00016553.1
851 IPI00016568.1 Adenylate kinase isoenzyme 4, mitochondrial Mito(SP,MitoP2) 1.74E-01 (IAQNFGLQHLSSGHFLR;SLLVPDHVITR;RGQHWLLDGFPR;GQHWLLDGFPR) 2.05E-01 (DVAKPVIELYK;IWPYVYTLFSNK;IAQNFGLQHLSSGHFLR;VYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAAR) 4.43E-01 (IAQNFGLQHLSSGHFLR;RGQHWLLDGFPR;SLLVPDHVITR) 5.25E-02 (IAQNFGLQHLSSGHFLR;DVAKPVIELYK) - 2.34E-01 (IAQNFGLQHLSSGHFLR;VYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAAR;GVLHQFSGTETNK;DVAKPVIELYK) 1 IPI00016568.1
852 IPI00016597.3 Ceroid-lipofuscinosis neuronal protein 6 ER(SP,GO) - - - - - 1.30E-01 (YPGVIYVPEPWAFYTLHVSSR;LLFSGYQHHLSVR) 1 IPI00016597.3
853 IPI00016605.3 CDNA FLJ20580 fis, clone REC00516 Cyto(G1) - 1.53E-01 (AQESVGIYEVTHQFVK;TIVEFECR;TIVEFECRGLEPVDFQPQAGFAAEGVESGTAFSDINLQEK;ATLENITNLRPVGEDFR) - - - - 1 IPI00016605.3
854 IPI00016608.1 Transmembrane emp24 domain-containing protein 2 precursor ER(G1); Cyto(SP) 1.11E-01 (LEEMINELAVAMTAVK;IVMFTIDIGEAPK) - - 3.32E+00 (GQDMETEAHQNKLEEMINELAVAMTAVK;IVMFTIDIGEAPK;LEEMINELAVAMTAVK;YTFAAHMDGTYK) 3.67E+00 (GQDMETEAHQNKLEEMINELAVAMTAVK;IVMFTIDIGEAPK;LEEMINELAVAMTAVK;YTFAAHMDGTYK) - 1 IPI00016608.1
855 IPI00016610.2 Poly(rC)-binding protein 1 Cyto(G1,SP); Nucl(SP,GO) - 8.92E-01 (INISEGNCPER;AITIAGVPQSVTECVK;CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK;IITLTGPTNAIFK;LVVPATQCGSLIGK;QVTITGSAASISLAQYLINAR;MDAGVTESGLNVTLTIRLLMHGK) - 1.13E-01 (ESTGAQVQVAGDMLPNSTER;IITLTGPTNAIFK;QVTITGSAASISLAQYLINAR) - 1.75E+00 (INISEGNCPER;AITIAGVPQSVTECVK;CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK;IITLTGPTNAIFK;LVVPATQCGSLIGK;QVTITGSAASISLAQYLINAR) 1 IPI00016610.2
856 IPI00016613.2 CSNK2A1 protein Cyto(G2) - 9.93E-02 (HGGTIPIVPTAEFQDR;YSEVFEAINITNNEK;FVHSENQHLVSPEALDFLDK;GGPNIITLADIVKDPVSR;TPALVFEHVNNTDFK) - - - - 1 IPI00016613.2
857 IPI00016621.6 AP-2 complex subunit alpha-2 Cyto(G1,GO); PM(GO) 1.75E-01 (IIGFGSALLEEVDPNPANFVGAGIIHTK;LTECLETILNK;NAVLFEAISLIIHHDSEPNLLVR;QLSNPQQEVQNIFK;VGGYILGEFGNLIAGDPR;VVHLLNDQHLGVVTAATSLITTLAQK;VIQIVINR;FVNLFPEVKPTIQDVLR;THIETVINALK;IAGDYVSEEVWYR) 3.24E-01 (FFQPTEMASQDFFQR;FVNLFPEVKPTIQDVLR;GPSTVTDLEDTKR;IIGFGSALLEEVDPNPANFVGAGIIHTK;KGPSTVTDLEDTKR;LLFIFLLGHDIDFGHMEAVNLLSSNR;NAVLFEAISLIIHHDSEPNLLVR;NNGVLFENQLLQIGLK;QLSNPQQEVQNIFK;VGGYILGEFGNLIAG - 1.80E-01 (EMAEAFAGEIPK;VLVAGDTMDSVK;VVHLLNDQHLGVVTAATSLITTLAQK;THIETVINALK;NAVLFEAISLIIHHDSEPNLLVR;FFQPTEMASQDFFQR;FVNLFPEVKPTIQDVLR;GLAVFISDIR;LEPNLQAQMYR;NNGVLFENQLLQIGLK;VGGYILGEFGNLIAGDPR;YGGTFQNV 1.69E-01 (EMAEAFAGEIPK;VLVAGDTMDSVK;NAVLFEAISLIIHHDSEPNLLVR;THIETVINALK;FFQPTEMASQDFFQR;FVNLFPEVKPTIQDVLR;GLAVFISDIR;LSTVASTDILATVLEEMPPFPER;SNAPQIVAEMLSYLETADYSIR;VGGYILGEFGNLIAGDPR;YGGTFQNVSVQLPITLN 1.83E-02 (YGGTFQNVSVQLPITLNK;EEIVLKVAILAEK;VGGYILGEFGNLIAGDPR) 1 IPI00016621.6
858 IPI00016634.1 Protein C20orf11 Nucl(SP) - - - - - 6.51E-02 (YLYFHLQQQHLIELIR;GQIQEAIALINSLHPELLDTNR) 1 IPI00016634.1
859 IPI00016637.3 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial precursor Mito(SP,GO,MitoP2,HPA); Cyto(GO,HPA) - 2.50E-02 (VVITGIGLVTPLGVGTHLVWDR;GSDEGQFNEQNFVSK) - - - - 2 IPI00016637.3, IPI00789342.1
860 IPI00016669.1 GTP-binding protein Rheb Cyto(G2,GO) - 7.37E-02 (ALAESWNAAFLESSAK;ENQTAVDVFR) - - - - 1 IPI00016669.1
861 IPI00016670.2 FLJ20625 protein PM(SP,GO,HPA) - - - 9.26E-02 (IAAYAYSALSQIR;KLPPLPSLTSQPHQVLASEPIPFSDLQQVSR) - - 1 IPI00016670.2
862 IPI00016690.1 Serine/threonine-protein kinase LATS2 Nucl(G2,GO); Cyto(SP) - - 1.22E-02 (QTSPGKGLMPTPVTRR;PEPQTAVGPSHPAWVPAPAPAPAPAPAPAAEGLDAK) - - - 1 IPI00016690.1
863 IPI00016702.3 Rab6 GTPase activating protein, GAPCenA Nucl(G2); Cyto(SP) - 8.24E-03 (LEQENDDLAHELVTSK;LLDPQTNTEIANYPIYK) - 1.16E-02 (KDLDNAEEKADALNK;YRILITKESPQDSAITR) - - 1 IPI00016702.3
864 IPI00016703.2 24-dehydrocholesterol reductase precursor ER(SP,GO); Nucl(GO) 1.92E-01 (GNEAELYIDIGAYGEPR;LNSIGNYYKPWFFK;SIFWELQDIIPFGNNPIFR;EGLEYIPLR) - - 9.28E-01 (EEFWEMFDGSLYHK;GNEAELYIDIGAYGEPR;LYEQHHVVQDMLVPMK;EGLEYIPLR;LNSIGNYYKPWFFK;NIMINLMDILEVDTKK;QENHFVEGLLYSLDEAVIMTGVMTDEAEPSK;SIFWELQDIIPFGNNPIFR;YLFGWMVPPK;NIMINLMDILEVDTK) 5.76E-01 (EGLEYIPLR;GNEAELYIDIGAYGEPR;LNSIGNYYKPWFFK;NIMINLMDILEVDTK;NIMINLMDILEVDTKK;SIFWELQDIIPFGNNPIFR;LYEQHHVVQDMLVPMK;QENHFVEGLLYSLDEAVIMTGVMTDEAEPSK) - 1 IPI00016703.2
865 IPI00016764.1 Tyrosine aminotransferase Nucl(G1); Cyto(GO); Mito(MitoP2) - - - - - 1.68E-01 (GNLPSILDVHVNVGGR;TACLIVNNPSNPCGSVFSK;YEPLATLSTDVPILSCGGLAK;TPGEFYHNTLSFLK;ILGPCTIVQGALK;PGFSLYK) 1 IPI00016764.1
866 IPI00016786.1 Isoform 2 of Cell division control protein 42 homolog precursor Cyto(G1,GO); PM(GO) 1.93E-01 (NVFDEAILAALEPPEPK;TPFLLVGTQIDLR) 1.91E+00 (CVVVGDGAVGK;TCLLISYTTNK;TPFLLVGTQIDLR;TPFLLVGTQIDLRDDPSTIEK;WVPEITHHCPK;LRPLSYPQTDVFLVCFSVVSPSSFENVK;NVFDEAILAALEPPEPK;YVECSALTKK) - 3.89E-01 (NVFDEAILAALEPPEPK;TPFLLVGTQIDLR;TPFLLVGTQIDLRDDPSTIEK) 1.00E+00 (NVFDEAILAALEPPEPK;TPFLLVGTQIDLR) 4.95E-01 (TPFLLVGTQIDLR;LRPLSYPQTDVFLVCFSVVSPSSFENVK;NVFDEAILAALEPPEPK) 1 IPI00016786.1
867 IPI00016801.1 Glutamate dehydrogenase 1, mitochondrial precursor Mito(SP,GO,MitoP2); Cyto(GO) 4.52E+00 (DDGSWEVIEGYR;IIAEGANGPTTPEADK;IIAEGANGPTTPEADKIFLER;IIKPCNHVLSLSFPIR;TAAYVNAIEK;YNLGLDLR;YSTDVSVDEVK;LQHGSILGFPK;GFIGPGIDVPAPDMSTGER;DIVHSGLAYTMER;HGGTIPIVPTAEFQDR;DSNYHLLMSVQESLER) 6.75E-01 (AKPYEGSILEADCDILIPAASEK;CIAVGESDGSIWNPDGIDPK;GFIGPGIDVPAPDMSTGER;KGFIGPGIDVPAPDMSTGER;LQHGSILGFPK;TFVVQGFGNVGLHSMR;YSTDVSVDEVK;IIAEGANGPTTPEADK;IIAEGANGPTTPEADKIFLER;YNLGLDLR;IIKPCNHVLSLSFPI 2.98E+01 (AKIIAEGANGPTTPEADK;AKPYEGSILEADCDILIPAASEK;CIAVGESDGSIWNPDGIDPK;ELEDFKLQHGSILGFPK;IIAEGANGPTTPEADK;IIAEGANGPTTPEADKIFLER;LQHGSILGFPK;PYEGSILEADCDILIPAASEK;NIMVIPDLYLNAGGVTVSYFEWLK;CAVVDVPFGG 7.12E+00 (ALASLMTYK;ELEDFKLQHGSILGFPK;GFIGPGIDVPAPDMSTGER;GVFHGIENFINEASYMSILGMTPGFGDK;KGFIGPGIDVPAPDMSTGER;LQHGSILGFPK;TFVVQGFGNVGLHSMR;YSTDVSVDEVK;FTMELAK;IIAEGANGPTTPEADK;IIAEGANGPTTPEADKIFLER;NIMV 2.31E+00 (ALASLMTYK;GFIGPGIDVPAPDMSTGER;GVFHGIENFINEASYMSILGMTPGFGDK;KGFIGPGIDVPAPDMSTGER;LQHGSILGFPK;TFVVQGFGNVGLHSMR;YSTDVSVDEVK;FTMELAK;IIAEGANGPTTPEADK;IIAEGANGPTTPEADKIFLER;DDGSWEVIEGYR;YNLGLDLR; 6.09E+00 (AKPYEGSILEADCDILIPAASEK;CAVVDVPFGGAK;CIAVGESDGSIWNPDGIDPK;LQHGSILGFPK;TFVVQGFGNVGLHSMR;YSTDVSVDEVK;ALASLMTYK;IIAEGANGPTTPEADK;IIAEGANGPTTPEADKIFLER;YNLGLDLR;DDGSWEVIEGYR;IIKPCNHVLSLSFPIR;RDD 1 IPI00016801.1
868 IPI00016827.1 Bile acyl-CoA synthetase ER(SP,GO) 5.42E+00 (ALLVWTGPGAGSVTFGELDAR;GMPLAHSVLSSGAR;LGCPTAWINPHGR;QPPDTFVDAFER;WLPADVIFLAK;AWLPAYATPHFIR;CFYLSHTSPTPGVGALGAALDAAPSHPVPADLR;DNQGFCIPVGLGEPGLLLTK;EGFLYFR;EGFNVGIVVDPLFVLDNR;ESLEEILPK;FSTSCFWD 5.67E-02 (ALLVWTGPGAGSVTFGELDAR;DNQGFCIPVGLGEPGLLLTK;EGFNVGIVVDPLFVLDNR;SPALFIYTSGTTGLPKPAILTHER;CFYLSHTSPTPGVGALGAALDAAPSHPVPADLR) 3.75E-01 (ALLVWTGPGAGSVTFGELDAR;DNQGFCIPVGLGEPGLLLTK;EGFNVGIVVDPLFVLDNR;SPALFIYTSGTTGLPK;VLVVDPDLR;YLCNIPQQPEDR;SPALFIYTSGTTGLPKPAILTHER) 1.10E+01 (ADVWETFQQR;MLSPFELVQFDMEAAEPVR;ALLVWTGPGAGSVTFGELDAR;AQPGRALLVWTGPGAGSVTFGELDAR;AWLPAYATPHFIR;EGFLYFR;EGFNVGIVVDPLFVLDNR;ESLEEILPK;GMPLAHSVLSSGAR;IQDAMEVTSTFK;IWEVYGSTEGNMGLVNYVGR;PWLGPWVPHG 9.52E+00 (ADVWETFQQR;ALLVWTGPGAGSVTFGELDAR;AWLPAYATPHFIR;EGFLYFR;EGFNVGIVVDPLFVLDNR;GMPLAHSVLSSGAR;IQDAMEVTSTFK;IWEVYGSTEGNMGLVNYVGR;MLSPFELVQFDMEAAEPVR;QHGVTVILYVGELLR;QPPDTFVDAFER;QSGDVYYNTGDVLAMDR; 6.41E-01 (GENVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGK;ALLVWTGPGAGSVTFGELDAR;CFYLSHTSPTPGVGALGAALDAAPSHPVPADLR;DNQGFCIPVGLGEPGLLLTK;EGFNVGIVVDPLFVLDNR;SPALFIYTSGTTGLPK;SPALFIYTSGTTGLPKPAILTHER;VLVVDPDLR;VVSQQP 1 IPI00016827.1
869 IPI00016861.4 Isoform 1 of General transcription factor 3C polypeptide 2 Nucl(SP,GO) - - - - - 2.40E-02 (LQLEAIHKVR;TYTETVNHHYLLFQDTDLGSFHDLLR) 1 IPI00016861.4
870 IPI00016862.1 Isoform Mitochondrial of Glutathione reductase, mitochondrial precursor Cyto(G1,SP,GO); Mito(SP,MitoP2) - 3.58E-01 (ADFDNTVAIHPTSSEELVTLR;ALLTPVAIAAGR;LDYNNIPTVVFSHPPIGTVGLTEDEAIHK;LGGTCVNVGCVPK;LGIQTDDKGHIIVDEFQNTNVK;GHAAFTSDPKPTIEVSGK;LNAIYQNNLTK;LPVMTMIPDVDCLLWAIGR;SVIVGAGYIAVEMAGILSALGSK;EDSKLDYNNIPTV 8.50E-02 (ALLTPVAIAAGR;GHAAFTSDPKPTIEVSGK;LNAIYQNNLTK) - - - 1 IPI00016862.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home