Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
61 IPI00001639.2 Importin beta-1 subunit Cyto(SP,GO,HPA); Nucl(SP,GO,HPA) 5.37E-02 (LAATNALLNSLEFTK;AAVENLPTFLVELSR) 1.07E+00 (ESTLEAIGYICQDIDPEQLQDK;GALQYLVPILTQTLTK;GDQENVHPDVMLVQPR;LAATNALLNSLEFTK;LLETTDRPDGHQNNLR;NYAEYQVCLAAVGLVGDLCR;SDYDMVDYLNELR;SNEILTAIIQGMR;TTLVIMER;TVSPDRLELEAAQK;VQHQDALQISDVVMASLLR;YLEVVLN - 3.24E-02 (AAVENLPTFLVELSR;GALQYLVPILTQTLTK;LAATNALLNSLEFTK) 3.48E-02 (AAVENLPTFLVELSR;LAATNALLNSLEFTK;NSAKDCYPAVQK) 4.67E-01 (GALQYLVPILTQTLTK;LAATNALLNSLEFTK;YLEVVLNTLQQASQAQVDK;AAVENLPTFLVELSR;ESCLEAYTGIVQGLK;SVKPQILSVFGDIALAIGGEFKK;VAALQNLVK;IQFNDLQSLLCATLQNVLR;TVSPDRLELEAAQK) 1 IPI00001639.2
62 IPI00001655.1 transcription factor IIB Cyto(G2) - 8.09E-02 (NTFQSGFLSILYSIGSK;AYGTNYIETLR;LYSEDELPAEFK) - - - - 1 IPI00001655.1
63 IPI00001663.1 Isoform 1 of Serine protease HTRA2, mitochondrial precursor Mito(G2,SP,GO,MitoP2); ER(GO); Nucl(GO) - 3.13E-02 (AGLRPGDVILAIGEQMVQNAEDVYEAVR;LLSGDTYEAVVTAVDPVADIATLR;TQSQLAVQIR) - - 4.74E-02 (SQYNFIADVVEK;TQSQLAVQIR) - 3 IPI00001663.1, IPI00220542.1, IPI00220543.1
64 IPI00001671.1 Tumor necrosis factor precursor Mito(G1); PM(SP,GO) - - 4.84E-01 (PWYEPIYLGGVFQLEK;RANALLANGVELR) - - - 1 IPI00001671.1
65 IPI00001676.8 Isoform 2 of Nuclear protein localization protein 4 homolog Cyto(G2) - 6.33E-02 (DPVYTFSISQNPFPIENR;TGNQHFGYLYGR;VFGAPNVVEDEIDQYLSK;PLPVEYLIIDITTTFPK;ESSSEQYVPDVFYK) - - - - 2 IPI00001676.8, IPI00290543.5
66 IPI00001699.1 Isoform 1 of Apoptosis-associated speck-like protein containing a CARD Cyto(SP,GO) - 4.23E-01 (VLTDEQYQAVR;DAILDALENLTAEELK;DAILDALENLTAEELKK;ESQSYLVEDLER;DLLLQALR;PGLHFIDQHR) - - - - 2 IPI00001699.1, IPI00221362.2
67 IPI00001733.2 Doublesex- and mab-3-related transcription factor 1 Nucl(G2) - 3.53E-02 (PSTPSEAPHAPGVPPQGR;AGGFGKASGALVGAASGSSAGGSSR) - - - - 1 IPI00001733.2
68 IPI00001734.2 Isoform 1 of Phosphoserine aminotransferase Cyto(G1) - 1.12E+00 (ALELNMLSLK;FGTINIVHPK;FGVIFAGAQK;GAVLVCDMSSNFLSKPVDVSK;GVGISVLEMSHR;IINNTENLVR;IPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVK;KFGTINIVHPK;LPHSVLLEIQK;NVGSAGVTVVIVR;SQTIYEIIDNSQGFYVCPVEPQNR;VIFLQGGGCGQ - - 8.42E-02 (FGVIFAGAQK;ASLYNAVTIEDVQK;ALELNMLSLK) - 1 IPI00001734.2
69 IPI00001735.5 nuclear receptor co-repressor 2 isoform 1 Nucl(SP,GO,HPA) - - - - 9.02E-03 (DAEAAEATAEGALK;PRLELLPDPLLRPSPLLATGQPAGSEDLTK;TQSKPFSIQELELR) - 2 IPI00001735.5, IPI00219555.2
70 IPI00001738.4 Nuclear pore complex protein Nup88 Nucl(SP,GO,HPA); Cyto(GO) - - - - - 1.96E-01 (HAAWYPSEILDPHVVLLTSDNVIR;LLHSFHSELPVLSDSER;AYTASLGETAVAFDFGPLAAVPK;GPSGGGEEPALSQYQR;FLGSDEEDKDSLQELSTEQK;VLAETPDSFEK;EDVEVAESPLR) 1 IPI00001738.4
71 IPI00001753.1 Myosin-4 Cyto(G2,SP) - 1.89E-03 (CNGVLEGIR;GQTVQQVYNAVGALAKAIYEK) - - - - 1 IPI00001753.1
72 IPI00001754.1 Junctional adhesion molecule A precursor PM(SP,GO) 6.59E-01 (LIVLVPPSKPTVNIPSSATIGNR;VTFLPTGITFK) - - - 2.37E-01 (LIVLVPPSKPTVNIPSSATIGNR;VTFLPTGITFK) - 3 IPI00001754.1, IPI00069985.2, IPI00294993.2
73 IPI00001755.1 Glypican-6 precursor ER(G2); PM(GO) - - - - 5.35E-02 (LEFENLVEETSHFVR;TFVQGLTVGR;SARSAPENFNTR) - 1 IPI00001755.1
74 IPI00001757.1 Isoform 1 of RNA-binding protein 8A Cyto(SP,GO); Nucl(SP,GO,HPA) - - - - - 7.07E-01 (GYTLVEYETYK;EDYDSVEQDGDEPGPQR;FAEYGEIK) 2 IPI00001757.1, IPI00216659.1
75 IPI00001786.4 USP36 protein Nucl(SP,GO,HPA) - - 1.46E-02 (FTIHRTSNVLTLSLK;EATAAPHGKR;PEDTAASALQEGQTQRQPGSPMYR) - - - 1 IPI00001786.4
76 IPI00001849.3 KIAA1530 protein Nucl(G2) - - 1.48E-02 (YPSLTNLKAQADTAR;LSAFQIVEELFVR) - - - 1 IPI00001849.3
77 IPI00001869.2 Pappalysin-1 precursor Nucl(G1); Cyto(GO) - - - - - 1.45E-02 (RASPPPPPPPGGAWEAVR;YRVVNLYEDDHK) 2 IPI00001869.2, IPI00513756.1
78 IPI00001872.3 Isoform 1 of Protocadherin gamma C3 precursor PM(G2) 3.22E-02 (QLFALDLVTGMLTIKGR;QTLTVLIK) - - - - - 4 IPI00001872.3, IPI00031750.1, IPI00409667.1, IPI00409668.1
79 IPI00001891.1 Isoform Long of Ancient ubiquitous protein 1 precursor ER(SP,GO,HPA); Nucl(GO,HPA) - - - 3.41E-02 (LPPTPLLLFPEEEATNGR;LRPQSAQSSFPPSPGPSPDVQLATLAQR) 5.49E-02 (FPSSGPVTPQPTALTFAK;LPPTPLLLFPEEEATNGR;EVLPHVPLGVIQR) - 2 IPI00001891.1, IPI00215815.3
80 IPI00001914.1 Isoform 1 of FK506-binding protein 7 precursor ER(G2,GO,HPA) - - - 7.93E-02 (WFVLGVGQVIK;AEINLYLQR;EYNVYQHDEL) - - 2 IPI00001914.1, IPI00218686.3
81 IPI00001960.3 Chloride intracellular channel protein 4 Cyto(G1,SP,GO,HPA); PM(GO); Mito(SP,GO,MitoP2); Nucl(SP,GO) - 3.60E-01 (AGSDGESIGNCPFSQR;EEDKEPLIELFVK;GVVFSVTTVDLK;GVVFSVTTVDLKR;IEEFLEEVLCPPK;RKPADLQNLAPGTHPPFITFNSEVK;TDVNKIEEFLEEVLCPPK;DEFTNTCPSDKEVEIAYSDVAK;KPADLQNLAPGTHPPFITFNSEVK) - - 4.74E-02 (LDEYLNSPLPDEIDENSMEDIK;EVEIAYSDVAK) - 1 IPI00001960.3
82 IPI00002048.2 similar to Aldo-keto reductase family 1 member C3 (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase) (3-alpha-hydroxysteroid dehydrogenase type 2) (3-alpha-HSD type 2) (3-alpha-HSD type II, brain) (Prostaglandin F synthase) (PGFS) (Estradiol 17-beta.. Cyto(G2) - 9.12E-02 (QLEMILNKPGLK;RQLEMILNKPGLK;TPAQVALCYQLQR) - - - - 1 IPI00002048.2
83 IPI00002127.5 Heat shock regulated-1 Cyto(G2) - 3.16E-03 (KPVLCIGPTGTGKTLTISDK;FVISIDTISFDFKVMFEAPSELTQR;LPHLPLPPAPPTLSDLGQPR) 4.18E-03 (LTEAMTMMFEVQDLAVASPATVSR;PVLCIGPTGTGKTLTISDK;YLELNNNDIASFLKTYQTQGLLAQEVR) 4.46E-03 (QELKDIEDQILYR;LYLVHKTDEKGLVR) - - 1 IPI00002127.5
84 IPI00002149.1 GTP-binding protein SAR1b Cyto(G1,GO); ER(GO,HPA) - 2.45E+00 (EELDSLMTDETIANVPILILGNK;ELNARPLEVFMCSVLK;IDRPEAISEER;LVFLGLDNAGK;NYLPAINGIVFLVDCADHER;TTLLHMLK;EMFGLYGQTTGK;LGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQAR;LLESKEELDSLMTDETIANVPILILGNK;PLEVFMCSVLK) - 7.37E-02 (LVFLGLDNAGK;TTLLHMLK;EMFGLYGQTTGK) 5.08E-01 (EELDSLMTDETIANVPILILGNK;IDRPEAISEER;LVFLGLDNAGK;TTLLHMLK;EMFGLYGQTTGK) - 1 IPI00002149.1
85 IPI00002186.4 Brefeldin A-inhibited guanine nucleotide-exchange protein 2 Cyto(G2,GO) - 3.29E-03 (DAYVQALAR;SPRVVSTSLDCLQK) - - 7.48E-03 (NLINQTTAKATLTQMLNVIFTR;EAWTSLLLLLLTKTLKINDEK) - 1 IPI00002186.4
86 IPI00002188.2 Brefeldin A-inhibited guanine nucleotide-exchange protein 1 Cyto(G2,HPA); Nucl(HPA) - 7.03E-03 (LSVSSNDTQESGNSSGPSPGAK;DAYVQALAR;FPEQKLFAALLIK) - - 8.00E-03 (FPEQKLFAALLIK;YISGTVRGREGSLTGTK) 9.48E-03 (IVFRIFDNMKLPEQQTEK;DQAPDEFVGLGLVGGNVDWK) 1 IPI00002188.2
87 IPI00002230.3 Arylacetamide deacetylase-like 1 Nucl(G1) - - - - - 9.82E-02 (SAPLIADQAVLQLLPK;YFLKPEVLQK) 1 IPI00002230.3
88 IPI00002232.2 Isoform 1 of Serine/threonine-protein kinase TAO1 Cyto(SP,GO) - - - 1.77E-02 (TEQGMSR;KELNSFLESQKR) 1.26E-02 (KELNSFLESQKR;LQHQTELTNQLEYNKRR) - 1 IPI00002232.2
89 IPI00002243.4 Gamma-glutamyltransferase-like activity 1 ER(G1); PM(GO) - 2.37E-02 (LPWAQLFQPTIALLR;TGIILNNELLDLCER) - 1.68E-01 (LPWAQLFQPTIALLR;LVIGGAGGELIISAVAQAIMSK;SPSSMVPSILINK;AAIAAPILHVNSK) 3.62E+00 (AAIAAPILHVNSK;DLLGETLAQLIR;EGSQLTLQDLAK;FLHNSILRPSLQASTLR;LGQMLVEDIAK;LPWAQLFQPTIALLR;LVIGGAGGELIISAVAQAIMSK;LWLGFDLR;SPSSMVPSILINK;VNVYHHLVETLK) 1.07E-01 (LPWAQLFQPTIALLR;TGIILNNELLDLCER) 2 IPI00002243.4, IPI00339373.2
90 IPI00002245.4 hypothetical protein LOC79611 Mito(G1) - 5.79E-02 (THFAASVTDPER;IGAIHSLIFGGFASK;VDDVINVAGHR;VLAEHGVAALFTAPTAIR) 1.03E+00 (AQSHDCVPVLSEHPLYILYTSGTTGLPK;DINATEEQVLEEIVK;IAIIYDSPVTNTK;THFAASVTDPER;ISAGAIEESILSHGTVADCAVVGK;IGAIHSLIFGGFASK;RVEYVPLVEEALK;VDDVINVAGHR;VLAEHGVAALFTAPTAIR;PVGTPDAGAYFR;VEYVPLVEEALK) - - - 1 IPI00002245.4
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home