Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
871 IPI00016902.1 Probable G-protein coupled receptor 27 PM(G2) 8.95E-02 (MANASEPGGSGGGEAAALGLK;APYYLLLDLCLADGLR) - - - - - 1 IPI00016902.1
872 IPI00016906.1 Selenide, water dikinase 2 Cyto(G1) - 2.78E-01 (PLGTQVAVNAHQWLDNPER;YGEGHQAWIVGIVEK;FGLLQGTSAETSGGLLICLPR;NEVSFVIHNLPIIAK;TAAGLMHTFNAHAATDITGFGILGHSQNLAK;VIEVLPR;SFSNYRPFEPQALGLSPSWR) - - - 1.18E-01 (NEVSFVIHNLPIIAK;SFSNYRPFEPQALGLSPSWR) 2 IPI00016906.1, IPI00657969.1
873 IPI00016968.1 Succinate dehydrogenase cytochrome b560 subunit, mitochondrial precursor Mito(G1,SP,GO,MitoP2) 7.25E-01 (FALVFPLMYHTWNGIR;SLCLGPALIHTAK) - 4.10E-01 (FALVFPLMYHTWNGIR;SLCLGPALIHTAK) - - - 5 IPI00016968.1, IPI00289899.1, IPI00655681.1, IPI00656158.2, IPI00736192.1
874 IPI00017094.9 Isoform 3 of Lysosomal-trafficking regulator Cyto(G2); PM(G2) - - - 4.01E-03 (SRSLPAFPTSSLLTQSQK;TQLSTSDSEANSDEK) - 7.65E-03 (YETEEGVNKAAWQK;RMSQENPSQATETELAQR;SLPAFPTSSLLTQSQK) 3 IPI00017094.9, IPI00783614.1, IPI00796450.1
875 IPI00017160.3 Protein C6orf55 Cyto(G2,SP) - 5.58E-02 (YAGSALQYEDVSTAVQNLQK;MAALAPLPPLPAQFK;LYAMQTGMKIDSK) - - - - 1 IPI00017160.3
876 IPI00017184.2 EH-domain-containing protein 1 PM(SP) - 1.95E-02 (LDISDEFSEVIK;VYIGSFWSHPLLIPDNR;FHEFHSPALEDADFDNKPMVLLVGQYSTGK;LFEAEEQDLFK) - - 9.64E-02 (LDISDEFSEVIK;LNAFGNAFLNR;VYGALMWSLGK;VYIGSFWSHPLLIPDNR;EHQISPGDFPSLR;IGPEPTTDSFIAVMHGPTEGVVPGNALVVDPR;MQELLQTQDFSK) - 1 IPI00017184.2
877 IPI00017256.5 Ras suppressor protein 1 Nucl(G1); Cyto(GO) - 9.83E-02 (NLEVLNFFNNQIEELPTQISSLQK;ALYLSDNDFEILPPDIGK;DNDLISLPK;GFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLR;LTVLPPELGNLDLTGQK;EIGELTQLK) - - 7.45E-02 (ALYLSDNDFEILPPDIGK;LTVLPPELGNLDLTGQK;GISNMLDVNGLFTLSHITQLVLSHNK) 5.89E-01 (NLEVLNFFNNQIEELPTQISSLQK;ALYLSDNDFEILPPDIGK;GFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLR;LTVLPPELGNLDLTGQK) 1 IPI00017256.5
878 IPI00017262.1 Carbonic anhydrase 5A, mitochondrial precursor Mito(SP,MitoP2) - - 2.35E-01 (EAVVGENGLAVIGVFLK;TLLFSALGEEEK;EPVEVAPSQLSAFR) - - - 1 IPI00017262.1
879 IPI00017283.2 Isoleucyl-tRNA synthetase, mitochondrial precursor Mito(G1,GO,MitoP2,HPA) - 9.21E-02 (DQLGGWFQSSLLTSVAAR;SLGNVIHPDVVVNGGQDQSKEPPYGADVLR;VASVASTLETTFETISTLSGVDLENGTCSHPLIPDK;ELSNFYFSIIK;SCQTALVEILDVIVR;TALAEAELEYNPEHVSR;FPLLKPSPK;YTAESSDTLCPR;QQPDTELEIQQK) 1.01E+00 (AVLEEGTDVVIK;SGDLYVLAADK;SLGNVIHPDVVVNGGQDQSK;SLGNVIHPDVVVNGGQDQSKEPPYGADVLR;TKDEYLINSQTTEHIVK;TVIVHGFTLGEK;VASVASTLETTFETISTLSGVDLENGTCSHPLIPDK;ELSNFYFSIIK;SCQTALVEILDVIVR;SFAPILPHLAEEVFQHI - 2.20E-02 (EMTADVIELKGKFLINLEGGDIR;FIPGSALNGMVEMMDR) - 1 IPI00017283.2
880 IPI00017287.1 CDNA FLJ20701 fis, clone KAIA2204 Cyto(G2) - - - - 8.35E-02 (IHSNSSSEEVSQELESDDG;GEATVHMDTFQVAR) - 5 IPI00017287.1, IPI00384947.1, IPI00470789.3, IPI00744724.2, IPI00792193.1
881 IPI00017292.1 Isoform 1 of Catenin beta-1 PM(G1,GO,HPA); Cyto(SP,GO); Nucl(SP,GO) 3.42E+00 (AAVSHWQQQSYLDSGIHSGATTTAPSLSGK;AGDREDITEPAICALR;EAAEAIEAEGATAPLTELLHSR;EGLLAIFK;FLAITTDCLQILAYGNQESK;GLNTIPLFVQLLYSPIENIQR;HAVVNLINYQDDAELATR;LIILASGGPQALVNIMR;LLHPPSHWPLIK;LLNDEDQVVVNK;LSVE - 1.86E-02 (LAEPSQMLK;GLNTIPLFVQLLYSPIENIQR) 2.98E-02 (GLNTIPLFVQLLYSPIENIQR;LIILASGGPQALVNIMR) 1.60E-01 (GLNTIPLFVQLLYSPIENIQR;TSMGGTQQQFVEGVR;NEGVATYAAAVLFR;LIILASGGPQALVNIMR;LLNDEDQVVVNK;AAVSHWQQQSYLDSGIHSGATTTAPSLSGK) 3.72E-01 (AAVSHWQQQSYLDSGIHSGATTTAPSLSGK;HAVVNLINYQDDAELATR;AGDREDITEPAICALR;GLNTIPLFVQLLYSPIENIQR;NEGVATYAAAVLFR;NLALCPANHAPLR;VAAGVLCELAQDK;VAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSR;LLNDEDQVVVNK) 3 IPI00787237.1, IPI00787027.1, IPI00017292.1
882 IPI00017297.1 Matrin-3 Nucl(SP,GO,HPA) - - - - - 3.55E+00 (YQLLQLVEPFGVISNHLILNK;GYPHLCSICDLPVHSNK;IEELDQENEAALENGIK;ITPENLPQILLQLK;LCSLFYTNEEVAK;DLSAAGIGLLAAATQSLSMPASLGR;DSFDDRGPSLNPVLDYDHGSR;GAPPSSNIEDFHGLLPK;GDADQASNILASFGLSAR;GNLGAGNGNLQGPR;GPS 1 IPI00017297.1
883 IPI00017299.4 Polycomb group RING finger protein 4 Cyto(SP); Nucl(SP,GO,HPA) - 2.99E-02 (CPAAMTVMHLR;RIITDDEIISLSIEFFDQNR) - - - - 2 IPI00017299.4, IPI00643590.1
884 IPI00017303.1 DNA mismatch repair protein Msh2 Nucl(G1) - - - - - 1.12E-01 (LLLAVFVTPLTDLR;ALNLFQGSVEDTTGSQSLAALLNK;GDFYTAHGEDALLAAR;LNLVEAFVEDAELR;LYQGINQLPNVIQALEK;NNSFVNEIISR;DSLIIIDELGR) 1 IPI00017303.1
885 IPI00017334.1 Prohibitin Mito(G1,GO,MitoP2,HPA); Cyto(GO); Nucl(GO); PM(GO) 1.48E+01 (AAELIANSLATAGDGLIELR;AATFGLILDDVSLTHLTFGK;DLQNVNITLR;FDAGELITQR;FGLALAVAGGVVNSALYNVDAGHR;GVQDIVVGEGTHFLIPWVQK;GVQDIVVGEGTHFLIPWVQKPIIFDCR;IFTSIGEDYDER;ILFRPVASQLPR;KLEAAEDIAYQLSR;LEAAEDIAYQL - 1.04E+01 (AAELIANSLATAGDGLIELR;DLQNVNITLR;FGLALAVAGGVVNSALYNVDAGHR;AATFGLILDDVSLTHLTFGK;FDAGELITQR;GVQDIVVGEGTHFLIPWVQK;GVQDIVVGEGTHFLIPWVQKPIIFDCR;IFTSIGEDYDER;ILFRPVASQLPR;KLEAAEDIAYQLSR;NITYLPAGQSV 1.27E+00 (AAELIANSLATAGDGLIELR;AATFGLILDDVSLTHLTFGK;FDAGELITQR;FGLALAVAGGVVNSALYNVDAGHR;IFTSIGEDYDER;ILFRPVASQLPR;KLEAAEDIAYQLSR;NITYLPAGQSVLLQLPQ;VLPSITTEILK) 3.04E+00 (AAELIANSLATAGDGLIELR;AATFGLILDDVSLTHLTFGK;DLQNVNITLR;FDAGELITQR;FGLALAVAGGVVNSALYNVDAGHR;GVQDIVVGEGTHFLIPWVQK;IFTSIGEDYDER;ILFRPVASQLPR;KLEAAEDIAYQLSR;NITYLPAGQSVLLQLPQ;VLPSITTEILK) 3.44E+00 (AAELIANSLATAGDGLIELR;DLQNVNITLR;FGLALAVAGGVVNSALYNVDAGHR;AATFGLILDDVSLTHLTFGK;FDAGELITQR;GVQDIVVGEGTHFLIPWVQKPIIFDCR;IFTSIGEDYDER;ILFRPVASQLPR;KLEAAEDIAYQLSR;NITYLPAGQSVLLQLPQ;VLPSITTEILK;GV 1 IPI00017334.1
886 IPI00017339.1 Splicing factor 3B subunit 4 Nucl(G1,GO) - - - - - 9.28E-01 (LLYDTFSAFGVILQTPK;NLDVGANIFIGNLDPEIDEK;VTGQHQGYGFVEFLSEEDADYAIK;NQDATVYVGGLDEK) 1 IPI00017339.1
887 IPI00017342.1 Rho-related GTP-binding protein RhoG precursor Cyto(G1,GO); PM(GO) - 1.62E-01 (EQGQAPITPQQGQALAK;TCLLICYTTNAFPK;LKEQGQAPITPQQGQALAK;YLECSALQQDGVK;CVVVGDGAVGK) - 3.89E-01 (EQGQAPITPQQGQALAK;EYIPTVFDNYSAQSAVDGR;LKEQGQAPITPQQGQALAK) 6.96E-02 (EYIPTVFDNYSAQSAVDGR;EQGQAPITPQQGQALAK) 8.25E-02 (EYIPTVFDNYSAQSAVDGR;LKEQGQAPITPQQGQALAK) 1 IPI00017342.1
888 IPI00017344.3 Ras-related protein Rab-5B PM(SP) - - - 1.20E-01 (LVLLGESAVGK;YHSLAPMYYR;GAQAAIVVYDITNQETFAR;TAMNVNDLFLAIAK) 2.62E-01 (GAQAAIVVYDITNQETFAR;LVLLGESAVGK;TAMNVNDLFLAIAK;QASPSIVIALAGNK;YHSLAPMYYR) 4.19E-02 (LVLLGESAVGK;FEIWDTAGQER;GAQAAIVVYDITNQETFAR) 1 IPI00017344.3
889 IPI00017367.5 Radixin Mito(G1); Cyto(G1,SP); Nucl(GO); PM(SP,GO) 5.09E-01 (APDFVFYAPR;IGFPWSEIR;LFFLQVK;EVWFFGLQYVDSK;FFPEDVSEELIQEITQR;NQEQLAAELAEFTAK) 3.19E-01 (AFAAQEDLEK;APDFVFYAPR;EAILNDEIYCPPETAVLLASYAVQAK;FFPEDVSEELIQEITQR;IGFPWSEIR;KAPDFVFYAPR;NQEQLAAELAEFTAK;QLQALSSELAQAR;EVWFFGLQYVDSK;ILALCMGNHELYMR;LFFLQVK;IAQDLEMYGVNYFEIK;FVIKPIDK) - 5.84E-02 (APDFVFYAPR;IGFPWSEIR;EVWFFGLQYVDSK;FFPEDVSEELIQEITQR;NQEQLAAELAEFTAK) 4.34E-02 (APDFVFYAPR;KAPDFVFYAPR;IGFPWSEIR;EVWFFGLQYVDSK;NQEQLAAELAEFTAK) 1.63E-01 (APDFVFYAPR;IGFPWSEIR;EAILNDEIYCPPETAVLLASYAVQAK;FFPEDVSEELIQEITQR;NQEQLAAELAEFTAK) 1 IPI00017367.5
890 IPI00017373.1 Replication protein A 14 kDa subunit Nucl(SP,GO); Cyto(GO,HPA) - - - - - 3.44E-01 (ATILCTSYVQFK;IIHDFPQFYPLGIVQHD) 1 IPI00017373.1
891 IPI00017375.1 Protein transport protein Sec23A ER(SP,GO); Cyto(GO) - 4.42E-01 (ERPDLPPIQYEPVLCSR;GPCVSENEIGTGGTCQWK;ICGLSPTTTLAIYFEVVNQHNAPIPQGGR;IDMNLTDLLGELQR;ISGAIGPCVSLNSK;SGYQDMPEYENFR;AATTGHVIDIYACALDQTGLLEMK;AETEEGPDVLR;AVLNPLCQVDYR;FSETFSLYPQFMFHLR;GAIQFVTQYQHS - 2.95E-01 (FSETFSLYPQFMFHLR;GAIQFVTQYQHSSGQR;HLLQAPVDDAQEILHSR;IDMNLTDLLGELQR;IMMFIGGPATQGPGMVVGDELK;SSFLQVFNNSPDESSYYR;FGEYHKDDPSSFR;MVVPVAALFTPLK) 5.59E-01 (FSETFSLYPQFMFHLR;GAIQFVTQYQHSSGQR;HLLQAPVDDAQEILHSR;IDMNLTDLLGELQR;SGYQDMPEYENFR;SSFLQVFNNSPDESSYYR;MVVPVAALFTPLK;NQFPPSYAGISELNQPAELLPQFSSIEYVVLR) - 1 IPI00017375.1
892 IPI00017376.2 Protein transport protein Sec23B Cyto(G2) - 1.72E-02 (IDMNLTDLLGELQR;AVLNPLCQVDYR;HLLQAPLDDAQEILQAR;SPFLQVFNNSPDESSYYR) - - - - 1 IPI00017376.2
893 IPI00017381.1 Replication factor C subunit 4 Nucl(G1,GO) - - - - - 2.15E-01 (DLIDEGHAATQLVNQLHDVVVENNLSDK;SLEGADLPNLLFYGPPGTGK;VITDIAGVIPAEK) 1 IPI00017381.1
894 IPI00017451.1 Splicing factor 3 subunit 1 Nucl(G1,GO,HPA) - - - - - 2.60E+00 (ASKPLPPAPAPDEYLVSPITGEK;EDSAPSKPVVGIIYPPPEVR;FNFLNPNDPYHAYYR;IGEEEIQKPEEK;LNGQVLVFTLPLTDQVSVIK;LQYEGIFIK;QSDDEVYAPGLDIESSLK;EKQSDDEVYAPGLDIESSLK;NYQFDFLRPQHSLFNYFTK;RTDIFGVEETAIGK;RTDIFGVEET 1 IPI00017451.1
895 IPI00017469.1 Sepiapterin reductase Cyto(SP,HPA); Nucl(HPA) - 1.26E+00 (LLSLLEKDEFK;AVCLLTGASR;DMLFQVLALEEPNVR;LLLINNAGSLGDVSK;QLEAELGAER;TLAPLLASLLSPGSVLVLSAR;TVVNISSLCALQPFK;VLNYAPGPLDTDMQQLAR;VPADLGAEAGLQQLLGALR) 5.51E-01 (LLLINNAGSLGDVSK;TLAPLLASLLSPGSVLVLSAR;TVVNISSLCALQPFK;VPADLGAEAGLQQLLGALR;AFPDSPGLNR;LLSLLEKDEFK) - 1.21E-01 (DMLFQVLALEEPNVR;TLAPLLASLLSPGSVLVLSAR;VPADLGAEAGLQQLLGALR;LLLINNAGSLGDVSK) 2.59E-01 (TLAPLLASLLSPGSVLVLSAR;TVVNISSLCALQPFK;VPADLGAEAGLQQLLGALR) 1 IPI00017469.1
896 IPI00017510.3 Cytochrome c oxidase subunit 2 PM(G1); Mito(SP,GO,MitoP2) 4.23E+01 (IFEMGPVFTL;ILYMTDEVNDPSLTIK;LNQTTFTATR;MMITSQDVLHSWAVPTLGLK;VVLPIEAPIR) - 4.48E+00 (LNQTTFTATR;PGVYYGQCSEICGANHSFMPIVLELIPLK;VVLPIEAPIR) 2.27E+00 (IFEMGPVFTL;ILYMTDEVNDPSLTIK;LNQTTFTATR;VVLPIEAPIR) 3.65E+00 (IFEMGPVFTL;ILYMTDEVNDPSLTIK;LNQTTFTATR;VVLPIEAPIR) - 1 IPI00017510.3
897 IPI00017522.1 Potassium voltage-gated channel subfamily H member 4 PM(G2) 2.50E-02 (GQGGMKANNNVFEPK;DITQSGSPGLGPQGGR) - - - - - 1 IPI00017522.1
898 IPI00017530.1 Ficolin-2 precursor Nucl(G1) - - - - - 1.12E-01 (GCPGLPGAPGDKGEAGTNGKR;VDLVDFEDNYQFAK;LGEFWLGNDNIHALTAQGTSELR) 1 IPI00017530.1
899 IPI00017551.1 Regucalcin Cyto(G1) - 1.63E+00 (EEQIPDGMCIDAEGK;EQSAVVLATVDNDK;EQSAVVLATVDNDKK;IECVLPENCR;KYFDQVDISNGLDWSLDHK;LWVACYNGGR;YFDQVDISNGLDWSLDHK;CGESPVWEEVSNSLLFVDIPAK;CGESPVWEEVSNSLLFVDIPAKK;HQGALYSLFPDHHVK;VTMDAPVSSVALR;YFAGT - - 6.02E-02 (EQSAVVLATVDNDKK;YFAGTMAEETAPAVLER) - 1 IPI00017551.1
900 IPI00017579.1 Phenylalanine-4-hydroxylase Cyto(G1,GO) 9.21E-02 (IEVLDNTQQLK;ILADSINSEIGILCSALQK;DFLGGLAFR) 1.94E+00 (AYGAGLLSSFGELQYCLSEKPK;DEYEFFTHLDK;DEYEFFTHLDKR;ILADSINSEIGILCSALQK;KDEYEFFTHLDK;KDEYEFFTHLDKR;QFADIAYNYR;TAIQNYTVTEFQPLYYVAESFNDAK;YCGFHEDNIPQLEDVSQFLQTCTGFR;DFLGGLAFR;FANQILSYGAELDADHPGFK; - - - - 1 IPI00017579.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30]下一页最后一页Home