Liverbase v2.0
LiverbasePROTEOMESKY-LIVERHu2.0
 Database for liver-related genes , proteins and diseases
Back Home qHLOP-4961 HLP-12168 KEGG |
LDGP
Liver GO slim
ID IPI Description Subcellular localization Protein abundance and peptides identification GroSize ProGroup
PM Cyto Mito rER sER Nucl
91 IPI00002255.4 Lipopolysaccharide-responsive and beige-like anchor protein Cyto(G2); PM(G2) - 3.85E-02 (FAVLTGLVEVGEVSNR;LINDCHGSVSEASSEQK;NAGLAFIELVNEGR;SAAAIALPPIAK;YGPDAFFNFPGK;ATDAQLCLESSPK;SESYIGGNCYILSGSR;VGTVLLIMHTLK;LQATMETDDNIR;SFGQTPSQLLIEPHPPR;FPSNSPVTHVAANTQPGLATPAVITVTANR;RDINVSVG - - 5.58E-03 (IQNPQILKVIATLLR;RYLLQNTALEIFMANR) - 2 IPI00477088.1, IPI00002255.4
92 IPI00002270.3 UPF0364 protein C6orf211 Cyto(G1) - 3.26E-01 (CGADWEEYIK;FVDTDIWNQYLEYQQSLLNESDGK;LRNELQTDKPFIPLVEK;TIPWFVSDTTIHDFNWLIEQVK;IHEAIIQSPPIDYFDVFK;TIEDLDENQLKDEFFK;NELQTDKPFIPLVEK;YGIFQYDGPL;AHLILFK) - - - - 1 IPI00002270.3
93 IPI00002286.5 Ankyrin repeat domain-containing protein 11 Nucl(G2,SP) 8.31E-03 (QQSVPAASSYDSPMPPSMEDRAPLPPVPAEK;KETKSNSFISIPK) - - - 8.07E-03 (GLDDDTPLHDAANNGHYK;AILLENDLSTENKLK;ETKSNSFISIPK) - 2 IPI00002286.5, IPI00744988.1
94 IPI00002311.3 SCRN3 protein Cyto(G2) - 4.23E-02 (LYDEVQEVVYFPAVVHDNLGER;SVFKPFIFVPHISQLLDTSSPTFELEDLVK;EFDFAAAYSYLDTAK) - - - - 1 IPI00002311.3
95 IPI00002313.3 Caspase recruitment domain-containing protein 10 Nucl(G2) - 7.73E-03 (VLEEERAGLEQR;SQLQREQQLQARGR) - - - - 1 IPI00002313.3
96 IPI00002324.5 Methionine adenosyltransferase II, beta isoform 1 Cyto(G1,GO); Nucl(GO) - 3.03E-01 (EFQQNNWHAVGCGFR;VLVTGATGLLGR;FEQVNLLDSNAVHHIIHDFQPHVIVHCAAER;IPILYGEVEKLEESAVTVMFDK;LVEEEVNIPNR;RPDVVENQPDAASQLNVDASGNLAK;IPILYGEVEK;LETLGIGQR;GTFHWSGNEQMTK) - - - - 1 IPI00002324.5
97 IPI00002335.1 Huntingtin Cyto(SP,GO,HPA); ER(GO); Nucl(SP,GO,HPA) - 2.31E-02 (AISEEEEEVDPNTQNPK;PGGDFGTAFPEIPVEFLQEK;TLFGTNLASQFDGLSSNPSK;GYNLLPSITDVTMENNLSR;IQEYLQSSGLAQR;VGALHGVLYVLECDLLDDTAK;VIAAVSHELITSTTR;AFQSVLEVVAAPGSPYHR;SLLVVSDLFTER;NQFELMYVTLTELR;VLNNVVIHLLG - - - - 2 IPI00002335.1, IPI00783647.1
98 IPI00002372.1 ATP-binding cassette sub-family D member 3 Mito(G1); Cyto(GO) 1.18E+00 (DLNFEVR;EGGWDSVQDWMDVLSGGEK;EYLDNVQLGHILER;FDHVPLATPNGDVLIR;GIEGVQVIPLIPGAGEIIIADNIIK;IANPDQLLTQDVEK;NSSLAGAAFLLLCLLHK;VLGELWPLFGGR;YLYEEYLQAFTYYK;ITELMQVLK;FSMGFIDSIIAK;LITNSEEIAFYNGNK;LVEH - 1.99E+00 (EYLDNVQLGHILER;FDHVPLATPNGDVLIR;GIEGVQVIPLIPGAGEIIIADNIIK;YLYEEYLQAFTYYK;DLNFEVR;EGGWDSVQDWMDVLSGGEK;IANPDQLLTQDVEK;ITELMQVLK;NSSLAGAAFLLLCLLHK;SGANVLICGPNGCGK;VLGELWPLFGGR;KGISDLVLK;MGNLDNR 1.91E-01 (EYLDNVQLGHILER;GIEGVQVIPLIPGAGEIIIADNIIK;IANPDQLLTQDVEK;YLYEEYLQAFTYYK;ITELMQVLK;LFYVPQRPYMTLGTLR;VLGELWPLFGGR;FSMGFIDSIIAK;STHSELLEDYYQSGR;KLVEHLHNFILFR;LVEHLHNFILFR;YLATVVGYLVVSRPFLDLSHPR) 1.12E-01 (EYLDNVQLGHILER;GIEGVQVIPLIPGAGEIIIADNIIK;IANPDQLLTQDVEK;ITELMQVLK;FDHVPLATPNGDVLIR;VLGELWPLFGGR;YLYEEYLQAFTYYK;STHSELLEDYYQSGR) - 1 IPI00002372.1
99 IPI00002375.3 Tropomodulin-1 Cyto(G2,SP,GO) 8.79E-02 (DREDLVPYTGEK;LEEVNLNNIR;TLENELDELDPDNALLPAGLR) - - - - - 1 IPI00002375.3
100 IPI00002406.2 Lutheran blood group glycoprotein precursor PM(G2,GO) 5.90E-02 (VEDYDAADDVQLSK;LEVPVEMNPEGYMTSR) - - - 6.36E-02 (VAYLDPLELSEGK;VEDYDAADDVQLSK;LSVPPLVEVMR;LNVFAKPEATEVSPNK) - 3 IPI00002406.2, IPI00554618.2, IPI00794214.1
101 IPI00002415.3 Protein phosphatase 1, regulatory (Inhibitor) subunit 3B Cyto(G2) - - - 9.97E-02 (NEASGMVAPAVQEK;VSFADNQGLALTMVK) - - 1 IPI00002415.3
102 IPI00002459.4 annexin VI isoform 2 Cyto(G1) 4.43E-01 (DAFVAIVQSVK;EAILDIITSR;MTNYDVEHTIK;SLEDALSSDTSGHFR;SLHQAIEGDTSGDFLK;ILISLATGHREEGGENLDQAR;ALIEILATR;DLEADIIGDTSGHFQK;GLGTDEDTIIDIITHR;GTVRPANDFNPDADAK;MLVVLLQGTR;WGTDEAQFIYILGNR;DLIADLK;EDAQ 1.49E+00 (ALIEILATR;ALLALCGGED;EAILDIITSR;GFGSDKEAILDIITSR;MTNYDVEHTIK;SLEDALSSDTSGHFR;SLHQAIEGDTSGDFLK;DAFVAIVQSVK;DLMTDLKSEISGDLAR;GSIHDFPGFDPNQDAEALYTAMK;ILISLATGHR;ILISLATGHREEGGENLDQAR;LILGLMMPPA - - 4.11E+00 (DAFVAIVQSVK;DLMTDLK;DLMTDLKSEISGDLAR;EAILDIITSR;GFGSDKEAILDIITSR;GSIHDFPGFDPNQDAEALYTAMK;ILISLATGHR;ILISLATGHREEGGENLDQAR;LILGLMMPPAHYDAK;MTNYDVEHTIK;MTNYDVEHTIKK;SEIDLLNIR;SLEDALSSDTSGHFR;S - 1 IPI00002459.4
103 IPI00002460.2 Isoform 1 of Annexin A7 Cyto(G1) - 3.62E-01 (GFGTDEQAIVDVVANR;PAANFDAIR;TILQCALNRPAFFAER;DLLSSVSR;LGTDESCFNMILATR;VLIEILCTR;TILQCALNR;SEIDLVQIK;LLLAIVGQ) - - 7.78E-01 (DENQSINHQMAQEDAQR;GFGTDEQAIVDVVANR;PAANFDAIR;TLGTMIAGDTSGDYR;EFSGYVESGLK;SEIDLVQIK;DLLSSVSR) - 3 IPI00002460.2, IPI00021771.1, IPI00514510.1
104 IPI00002478.1 Isoform B of Endothelin-converting enzyme 1 PM(SP,GO) - - - - 2.39E-01 (ALNFGGIGVVVGHELTHAFDDQGR;NEIVFPAGILQAPFYTR;TPESSHEGLITDPHSPSR;ATLDEEDLVDSLSEGDAYPNGLQVNFHSPR;DNFQDTLQVVTAHYR;EKADAIYNMIGYPNFIMDPK;VFNDYTAVPDLYFENAMR;VLTGYLNYMVQLGK;WGTFSNLWEHNQAIIK;AFEESLSTL - 3 IPI00002478.1, IPI00216760.1, IPI00216762.1
105 IPI00002483.4 Zinc transporter 1 PM(G2,GO) - - - - 4.01E-02 (DVFHNHGIHATTIQPEFASVGSK;ESALILLQTVPK) - 2 IPI00002483.4, IPI00784764.1
106 IPI00002496.2 GDP-mannose pyrophosphorylase B isoform 1 Cyto(G1) - 2.49E-01 (ALILVGGYGTR;YGVVVCEADTGR;FVEKPQVFVSNK;ISMSHEEEPLGTAGPLALAR;LCSGPGIVGNVLVDPSAR;LRPLTLSTPK) 3.88E-02 (AYPLLEVRMENVTVLGEDVIVNDELYLNGASVLPHK;MKALILVGGYGTR) - - - 1 IPI00002496.2
107 IPI00002503.2 Cyclic AMP-dependent transcription factor ATF-4 Cyto(SP); PM(SP); Nucl(SP,GO) - - - 6.27E-02 (AGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLK;EIQYLKDLIEEVR) - - 1 IPI00002503.2
108 IPI00002506.1 Dolichyl-phosphate beta-glucosyltransferase ER(G1,GO) 5.20E-02 (IPIAEIAVNWTEIEGSK;QLSVVVPSYNEEK) - - 4.39E-01 (DPAFTYEVIVVDDGSKDQTSK;ILMADADGATKFPDVEK;IPIAEIAVNWTEIEGSK;LPVMMDEALSYLEK;QLSVVVPSYNEEK;RLPVMMDEALSYLEK;ETLPSIWDSPTK;HEEEKFFLNAK) 3.87E-01 (DPAFTYEVIVVDDGSK;DPAFTYEVIVVDDGSKDQTSK;ILMADADGATKFPDVEK;RDPAFTYEVIVVDDGSKDQTSK;LPVMMDEALSYLEK;QLSVVVPSYNEEK;RLPVMMDEALSYLEK;ETLPSIWDSPTK) - 1 IPI00002506.1
109 IPI00002519.1 Isoform 1 of Serine hydroxymethyltransferase, cytosolic Cyto(SP,GO,HPA); Nucl(GO,HPA) - 3.39E+00 (ISATSIFFESMPYK;DSDVEVYNIIK;EILYNLESLINSAVFPGLQGGPHNHAIAGVAVALK;IADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHK;IVTGGSDNHLILVDLR;LDPQCWGVNVQPYSGSPANFAVYTALVEPHGR;LIIAGTSCYSR;MLAQPLKDSDVEVYNIIK;VLEA 9.85E-02 (VNPDTGYINYDQLEENAR;AVLEALGSCLNNK;VGLELIASENFASR;IVTGGSDNHLILVDLR;ALSEALTELGYK;YYGGTEFIDELETLCQK) 2.57E-01 (ALSEALTELGYK;ISATSIFFESMPYK;MLAQPLKDSDVEVYNIIK;VGLELIASENFASR;VNPDTGYINYDQLEENAR;IVTGGSDNHLILVDLR) 3.10E-01 (ALSEALTELGYK;ISATSIFFESMPYK;IVTGGSDNHLILVDLR;MLAQPLKDSDVEVYNIIK;VGLELIASENFASR;VNPDTGYINYDQLEENAR;LAGDKYQAAVQALREEVESFASLFPLPGLPDF) 4.83E+00 (EILYNLESLINSAVFPGLQGGPHNHAIAGVAVALK;IVTGGSDNHLILVDLR;LDPQCWGVNVQPYSGSPANFAVYTALVEPHGR;LIIAGTSCYSR;VLEACSIACNK;VNPDTGYINYDQLEENAR;ALSEALTELGYK;AVLEALGSCLNNK;LAGDKYQAAVQALR;VGLELIASENFASR;YYGG 1 IPI00002519.1
110 IPI00002520.1 Serine hydroxymethyltransferase, mitochondrial precursor Mito(SP,GO,MitoP2,HPA); Cyto(HPA) 1.99E-01 (TGLIDYNQLALTAR;VLELVSITANK;VVDFIDEGVNIGLEVK;LGAPALTSR;LNPKTGLIDYNQLALTAR;YYGGAEVVDEIELLCQR) 1.24E-01 (AHLLADMAHISGLVAAK;TGLIDYNQLALTAR;GYSLVSGGTDNHLVLVDLRPK;LIIAGTSAYAR;VLELVSITANK;AALEALGSCLNNK;RALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR;YYGGAEVVDEIELLCQR;ISATSIFFESMPYK) 2.44E+00 (AHLLADMAHISGLVAAK;TGLIDYNQLALTAR;GYSLVSGGTDNHLVLVDLRPK;LIIAGTSAYAR;VLELVSITANK;VVDFIDEGVNIGLEVK;EYSLQVLK;YYGGAEVVDEIELLCQR;AALEALGSCLNNK;ALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDR) 1.53E-02 (ISATSIFFESMPYK;TGLIDYNQLALTAR) - 4.45E-01 (TGLIDYNQLALTAR;GYSLVSGGTDNHLVLVDLRPK;VLELVSITANK;AHLLADMAHISGLVAAK;LIIAGTSAYAR;INFAVFPSLQGGPHNHAIAAVAVALK;AALEALGSCLNNK;YYGGAEVVDEIELLCQR) 2 IPI00002520.1, IPI00789370.1
111 IPI00002523.1 Isoform 1 of Kynurenine--oxoglutarate transaminase 1 Cyto(SP,GO,HPA); Nucl(GO,HPA) - 1.01E-01 (ILASFFGELLGQEIDPLR;RLDGIDYNPWVEFVK;GLVAIPVSIFYSVPHQK) - - - - 1 IPI00002523.1
112 IPI00002525.3 Neudesin precursor ER(G1) - - - 1.24E+00 (AKYPIVGYTAR;ELEALDEVFTK;GVVFDVTSGK;ILNEDGSPNLDFKPEDQPHFDIKDEF;LFTEEELAR;MSLDPADLTHDTTGLTAK;YGGEEEDQPIYLAVK;YPIVGYTAR) 2.88E-01 (ELEALDEVFTK;MSLDPADLTHDTTGLTAK;YGGEEEDQPIYLAVK;ILNEDGSPNLDFKPEDQPHFDIKDEF) - 1 IPI00002525.3
113 IPI00002535.2 FK506-binding protein 2 precursor ER(G1) 1.17E+00 (IPGGATLVFEVELLK;KLVIPSELGYGER;LEDGTEFDSSLPQNQPFVFSLGTGQVIK;LVIPSELGYGER) - - 4.68E+00 (GAPPKIPGGATLVFEVELLKIER;IPGGATLVFEVELLK;IPGGATLVFEVELLKIER;KLVIPSELGYGER;LEDGTEFDSSLPQNQPFVFSLGTGQVIK;LVIPSELGYGER) 4.46E+00 (IPGGATLVFEVELLK;IPGGATLVFEVELLKIER;KLVIPSELGYGER;LEDGTEFDSSLPQNQPFVFSLGTGQVIK;LVIPSELGYGER) - 1 IPI00002535.2
114 IPI00002538.1 Isoform 1 of 3-phosphoinositide-dependent protein kinase 1 Cyto(G2,SP,GO); Nucl(GO); PM(GO) - - - 2.31E-02 (ELATSREYAIK;LYFTFQDDEK) - - 7 IPI00002538.1, IPI00216646.3, IPI00216647.1, IPI00478389.1, IPI00735470.1, IPI00749509.3, IPI00783157.1
115 IPI00002545.2 Paraneoplastic neuronal antigen MA3 Nucl(G2) - - - 2.52E-02 (EIPGKGGPWEVIVK;PPARITGVGAVPLPASGNSFDVRPSQGYR) - - 2 IPI00002545.2, IPI00647542.1
116 IPI00002547.1 Calpain-6 Cyto(G2) - 1.27E-02 (ELTLDMPK;KYANETVNPYLVIKCGK) - - - - 1 IPI00002547.1
117 IPI00002557.1 Coatomer subunit gamma-2 Cyto(G2) - 2.56E-02 (ELAPAVSVLQLFCSSPK;VVVVQAISALCQK;SIATLAITTLLK;FGAQNESLLPSILVLLQR;AIVDCIISIVEENPESK;SSEPVQLTEAETEYFVR;ETEDGHESPLFDFIESCLR) - - - - 3 IPI00744542.2, IPI00719430.3, IPI00002557.1
118 IPI00002564.3 DNA-repair protein XRCC1 Nucl(SP,GO,HPA) - - - - - 7.19E-02 (HFFLYGEFPGDER;ILQGVVVVLSGFQNPFR) 1 IPI00002564.3
119 IPI00002580.1 Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide Cyto(G2,SP); Nucl(SP); PM(SP) - - - - 1.15E-02 (VTMVNADPLGEEINVMFKVGEDLR;ETLRQRELQLSVLSAESLR;VNGKSLSVATVTRSQSLNIR) - 1 IPI00002580.1
120 IPI00002657.1 Isoform 1 of Copine-7 Cyto(G2) - 8.58E-03 (DIVQFVPFR;DIVQFVPFRELK) - - - - 2 IPI00219004.1, IPI00002657.1
第一页:前一页[1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,]下一页最后一页Home